CAZyme Information: MGYG000004146_00762

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1397
• CAZyme ID: MGYG000004146_00762
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000004146_15|CGC1	38482.25	4.9335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004146	2399745	MAG	United Kingdom	Europe

• Gene Location: Start: 26867; End: 27871 Strand: +

Full Sequence      

MMKGFGRFDPPIDPCANERTRRILAFFEEIYGEKILSGQYTNHGADTETELLFRETGRYP
AVRGFDFINDSPALSSRTGRDAELAVKWSGEGGLVTFSWHWFAPCGRPAFYAEHTDFDLS
KAVTTLDVASLPPEELDALWRDGRITTECRLLLRDIDAISVRLRWLEEQNVTVLWRPLHE
AAGGWFWWGSWGRDAYLWLWKLMVRRQNGYHGLHNLLWVWNGQAADWYVGDDQCDILGDD
VYVSPRDYGAQTDRFAALSRCSSRKMAALTECAVIPDPDELRREAAGWLWFNVWCREFVT
DEQGRYSEAYTERAVLQKAYHSSLVLTRGDLPAF

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	13	329	6.3e-88	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.84e-41	12	330	1	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.80e-04	56	242	42	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41451.1	1.04e-111	12	334	187	510
BCJ93286.1	4.03e-111	12	334	188	511
BCN30045.1	1.66e-109	12	334	187	510
ACX63523.1	4.59e-90	12	332	16	334
ANY72642.1	6.50e-90	12	332	16	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	8.78e-63	13	331	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	7.35e-57	11	331	6	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	1.26e-46	16	334	50	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	1.31e-46	11	334	34	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.01e-33	11	310	23	316	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.11e-61	13	331	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	6.67e-57	13	332	148	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	7.03e-53	12	301	29	309	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
Q5AWB7	1.41e-45	11	331	28	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	5.40e-43	12	334	158	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004146_00762.