CAZyme Information: MGYG000004136_02009

Basic Information

• Species: Eisenbergiella sp900555195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900555195
• CAZyme ID: MGYG000004136_02009
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	MGYG000004136_50|CGC2	69564.89	4.1746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004136	3901051	MAG	United Kingdom	Europe

• Gene Location: Start: 17225; End: 19177 Strand: -

Full Sequence      

MSGRRRRRHRRRRQESWKIFLPAGAAVVVLAVIGIAVLIGTGGKKEAAAQPEETETSVRE
EELAVEETQAAQESSEAESEQAGTQEASEEETAIAAEVGSQDDSEDPQASANAAGSGSGA
AVDVGELALAEGETDELTLGIDVSKYQGTIDWEQVKDAGVDFAMIRVGYRTKVSGIIYED
PGARYNLQEATKNGILAGAYFFSSAVTEEEARQEASWVADFIAKYKITYPVAYNCEDFQS
QDSRQYGLDSAARTQIACTFLDTIAARGYTPMFYASRNEMEGNALWDMDTLGSKYRVWVS
QYPEKPYPETPASTYSGTHAMWQYTSQGRVAGIDGSVDVNLAYFGYSEEAQAKDPNPAEI
VEANPEVGLNFTEVDELVTAKDETNLRNLPTTEGSQVVYKLPNGEAVQRTGIGSNGWDRV
IYNGQRLYAVHNFLTTDLTPQGDAAQGEETQSGAAQAAAGEGTSGSDAGSSDTSTGTSGA
DGSASSGGEEGPVFQAVSEAVTARDRVNLRDYPSTVTGNIVGSLSYGEAVVRTGISDTGW
SRLEVNGQVVYASSRLLATSMDYKEQEKPSPENPEAGMHFTAASGMVKAKDGQTNLRTLP
TTNEPSQVVGQLIGDATAQRVAQDVDRGWTKLIYNGQTVYAVSNYLTDAG

Enzyme Prediction     

No EC number prediction in MGYG000004136_02009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	141	333	9.8e-43	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	7.13e-71	140	343	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.87e-34	140	342	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	4.72e-28	141	333	1	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	4.40e-24	139	341	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
COG3757	Acm	4.83e-21	140	353	65	262	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR77025.1	8.92e-133	107	558	56	482
CBK89713.1	1.26e-132	107	558	56	482
CBK93417.1	7.94e-131	107	558	56	482
CUH92515.1	3.95e-130	133	557	97	485
ACR73526.1	2.22e-121	133	558	116	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.24e-18	141	343	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	5.28e-18	141	343	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRT_A	5.79e-12	140	424	22	273	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	2.37e-11	140	340	7	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.29e-10	140	340	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.65e-10	131	422	2	260	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	3.53e-10	140	340	84	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
Q8X7H0	5.33e-09	140	352	69	263	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42