CAZyme Information: MGYG000004136_00367

Basic Information

• Species: Eisenbergiella sp900555195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900555195
• CAZyme ID: MGYG000004136_00367
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1018	MGYG000004136_5|CGC1	114975.06	5.0201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004136	3901051	MAG	United Kingdom	Europe

• Gene Location: Start: 31625; End: 34681 Strand: -

Full Sequence      

MPEGEKRQSRFFQRVERKGNQMSLKGVYAPYFKIGAAVPAQDMESAAAREALRREYGSIT
CENEMKPERLLDETENKAHPEKYALAPAVHFDKVRAYLDFAAQNGMQMRGHTLVWHNQTP
RWFFAEGYQDGEDAPLADRETMLARLESYIRSVLTYFQTEYPGLIYAWDVVNEAVEDGGL
RRSLWTETVGEDFILQAFRFARKYAAPEVSLFYNDYDTFLPWKREAIIEKVLRPLMAEGL
ADGVGMQSHLTMDKPNLTEYEKTLRAFGELGIQVQITELDIHNTDPSGKSMEALAERYRE
IFSILVQAKKDGGANVTGVTFWGMQDEESWLTGFRGAKSYPLLFSNGYRPKLACQAVLGV
PGLAEGDSQDRLPGGQRFDFWEEDCVYTKEYHVNPSNPAASDENDGSMEKPFATIQAAAN
LAVPGTRVWIHGGVYRECVKPAFGGNGPKEMVCYEAYGDGEAVIKASEIAEDFRPSVGWR
LGSIGGSPEETEGLRIWETRLDPNKFRGYNPFCAVNILHDRLYIEYDKTDMTTYLNRRGM
VFCDGKPLQQVALYYQMAQTPGSYWVEANGQTVHFRLPDDGDPKDHVIELTCREQCFAPE
IPFLSYIKVKGLTCAHAATGAPVPQRGAVSCYRGHHWIIENCRIDWSNGVGMDVGNECWH
HTHEAGEVIGHTIIRGCTVSGAGVCGIAGMFATDLLIEDNLIEDTGWQKMELSWEAGAIK
VHNTHNSLIRRNIFTRTLRADHLWMDVGNENNRITRNLFLEGKEQREAIFIECSRDGINL
IDNNIFWNVEGRFRPEEVPAEPGSSGWYKMEETSVINGYAVYGEGTDRLHIVNNLIGKCR
SAGYYAKQVAFRIPGAGGRGGTSREARIANNLFYDCGEAAIKFPTRDNDAQGNLYVRMPG
GYLRVLYPAPAACLDLNTWKEFYGFDREGQEGWFDIEVDTEAYTLTIKEAQTQPFRFPGD
EEKNRYILRPEDADSVQDSLEVHEDFYGTRATGRRIPGPFAQPHLGRYSIDPRQGREE

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	23	358	3.6e-92	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.80e-110	24	358	1	309	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.14e-90	65	357	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	6.12e-68	23	357	1	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam13229	Beta_helix	1.89e-14	627	788	1	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.06e-11	625	784	22	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ59395.1	0.0	372	1014	9	653
BCK00936.1	0.0	372	1014	31	672
VCV24174.1	0.0	371	1014	6	650
CBL13370.1	0.0	371	1014	7	651
CBL10143.1	0.0	371	1014	6	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NL2_A	1.48e-64	23	372	11	350	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]
6D5C_A	6.23e-63	23	358	22	348	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
2W5F_A	3.29e-62	24	370	184	538	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6WQW_A	4.93e-62	21	362	3	331	ChainA, Beta-xylanase [Thermobacillus composti]
5Y3X_A	2.21e-60	23	353	31	350	Crystalstructure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_B Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_C Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_D Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_E Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_F Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.82e-131	22	384	1	355	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
Q60037	5.84e-62	23	442	369	761	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
P23556	8.76e-61	22	358	15	340	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q60042	3.44e-60	23	442	365	757	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
P51584	2.96e-59	24	370	195	549	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004136_00367.