CAZyme Information: MGYG000004134_01403

Basic Information

• Species: CAG-1427 sp900554685
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp900554685
• CAZyme ID: MGYG000004134_01403
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789	MGYG000004134_15|CGC1	89472.57	7.1718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004134	1949044	MAG	United Kingdom	Europe

• Gene Location: Start: 3969; End: 6338 Strand: -

Full Sequence      

MNFKTIMICRGEGVIDFHLQAISPATFNNAQFKASTNYCNNIPATIFIYETHGSDITDVI
VSVPLLEFKHIVISAKIGAERFEKKFSKRSITLQSKINYALKPVKALDIREFYLENYSNN
ISIQPSCMNIDPNNQSQFLIRGRLVVPGKQENIELFFSDITGQKKNSIDFSFSHQSTKRG
IACSVYSFSSRLVLKPNGGCIIAKSQSGRTGFFTLNPINFDPIYNHLSTRGYSLAKPGVY
DLFQKKQKNLRKVYASTTNIAYDSAPLFSIVVPLFETPALFFQEMISSVLIQSYQKWELI
LVNASPSNATLKKLIDQIDDNRVKTISLNKNLGIANNTNAGVARAQGDFIFFLDHDDTIE
PDALLRYWSYLQTYPNSDILYCDEDFLTEAHTYINPHFKPDFSIDLLRVHNYITHFLAVR
SSLLDKDPLDPAYNGAQDYDLVLRLSEKTKHFTHIPEVLYHWRMSDQSTAKNANNKSYAI
DAGKSALKAHLKRCGLPARVLDDEAACFYRVEYQIKNTPLVSIIIPNKDQVATLDRCLTS
IQNKTTYENYEILIIENNSEQEATFAYYKKAEEKWSNLSVVYWANEFNYSAINNFGASVS
KGKYLVLLNNDTEVISSNWIESLLGYCQRDDVGVVGAKLLYPDNSVQHAGIQIKKPKTAL
DSINPIHIFQQLDRDDPGYMRRAVIPQNVLAVTGACLMTKRSLYNDLSGLDEHLSVAYND
IDYCLKVHDSGLNIVFNPHALLYHHESISRGIDDETSSVNYTRFLSEQGILQAKWSKVLA
TDDPYHRFG

Enzyme Prediction     

No EC number prediction in MGYG000004134_01403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	269	383	6.2e-20	0.6764705882352942
GT2	522	704	5.6e-19	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.71e-77	266	464	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.90e-33	523	746	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.19e-23	517	751	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.62e-22	269	469	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.20e-17	281	382	11	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB07226.1	7.64e-212	1	786	1	789
ACV56006.1	4.49e-166	212	785	250	815
QOY61387.1	4.86e-162	9	785	9	792
AZH69456.1	5.17e-162	1	785	16	806
ATP53720.1	2.04e-161	1	785	16	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	2.60e-08	265	488	12	221	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.53e-94	263	786	363	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.84e-79	266	753	319	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q7BLV3	4.00e-08	241	693	415	839	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q57022	4.23e-08	266	371	4	109	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
Q9CMP0	5.24e-08	266	476	433	644	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004134_01403.