CAZyme Information: MGYG000004133_00786

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000004133_00786
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		40798.18	5.203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004133	2160156	MAG	United Kingdom	Europe

• Gene Location: Start: 25751; End: 26821 Strand: -

Full Sequence      

MVLDKIIEERKIPEVWDGKESWDKRREEIKELLMREEYGIVPPDPTDLTFEVLDEHPNKI
NTFCAGRASIRKMLCKGKVYGREFSFPFFCVLPIGKTNVPFFIHINFRDDNPDRYQPTEE
ITDNGFAVLTVCYSDVTSDDGDFTNGLAGVLFDGKERKPDDPGKIMMWAWAASRVMDYAM
SLDCLDKTRGAVVGHSRLGKTALVAGMIDQRYYAAISNDSGCSGAAITRDKTGETVERIC
RVFPYWFCENYYKYANREHDMPFDQHFLVAASAPRKVYVASAFEDKWADPDSEYLSCVLA
GRVYEKLGLAGFVADDALPLPTKSYHEGNVGYHIREGEHYLSREDWNNYFKFMNKR

Enzyme Prediction     

No EC number prediction in MGYG000004133_00786.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	19	355	2.2e-73	0.9219330855018587

CDD Domains     

MGYG000004133_00786 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	5.29e-104	20	355	27	359
ALL53565.1	1.46e-80	3	355	4	357
QOV20253.1	5.84e-77	3	352	4	354
QTN32611.1	1.69e-74	23	355	86	422
QDU37053.1	1.15e-70	13	355	57	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EHN_A	3.43e-56	15	352	26	394	Structuralinsight into a promiscuous CE15 esterase from the marine bacterial metagenome [unidentified prokaryotic organism]
6GRW_A	2.21e-54	117	355	156	395	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	3.37e-54	117	355	174	413	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	4.83e-54	117	355	185	424	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	9.28e-54	117	355	174	413	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	4.09e-55	15	352	54	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
B2ABS0	2.29e-19	18	308	137	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
D8QLP9	1.76e-14	20	309	52	325	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CU53	6.17e-14	21	312	62	342	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
G0RV93	5.67e-13	19	310	126	398	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004133_00786.