CAZyme Information: MGYG000004124_00598

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; QAKW01
• CAZyme ID: MGYG000004124_00598
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	MGYG000004124_9|CGC1	65332.4	5.0585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004124	1823169	MAG	United Kingdom	Europe

• Gene Location: Start: 20730; End: 22445 Strand: -

Full Sequence      

MEFFVLGLNDNAHVSLNTCEKNGIVYVDIKMTLDGESIPEKFKIRWSFPDTDCYSTWSPS
LKADRFLAPNWRKRKTESRLASWMPVQSLISMSGQNRLCIALSDTKTPVSIATGIREETA
AFDCDVEFFTVPTAAIKEYSATLRLDTRDIPYYDSIYDVTRWWEEDCGYSPAYVPEHARL
PMNSLWYSFHQQLDPDEIIRQCKLSKPLGMDTVIIDDGWQTDDNNRGYAYCGDWEVTPTK
FPDMREFVDRVHAEGMKVMLWYSVPYIGVHSKAYQKFHDMLLDSSGKEWFCADPRFKEVR
GFLTETYVNAVRSWGLDGLKLDFIDAFKLNGKSLEYDPRRDYTSLEDAIDALMNEVTAAL
REINPEILIEFRQSYIGPTIRKYGNMLRVGDCPNDAIRNRCAVVDMRLTSGNTPVHSDML
MWNYGDTVESAALQFANILYSVPQISMLIDRLSDEHFKMLRYYLSFWREHRKILLDGRLT
ATNPESCYGIVRADLDMRAVITLYNETMVENVGKYAAVVNASRSGTVYVKDCAGREYEIV
SCTGKKLQSGVFGSEGISAVNVPMCGILFVK

Enzyme Prediction     

No EC number prediction in MGYG000004124_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	186	511	1.3e-34	0.4883720930232558

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.97e-64	178	469	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	2.28e-13	181	351	2	147	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.17e-12	205	322	67	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	5.23e-12	173	537	287	655	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	2.16e-11	211	326	35	154	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41069.1	1.37e-181	7	570	18	588
CQR57728.1	4.49e-172	7	571	15	588
QMV40951.1	5.27e-169	2	571	9	586
QJD86820.1	6.31e-166	7	570	13	600
AZS17022.1	6.87e-164	23	568	29	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	1.07e-10	96	288	256	438	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	6.60e-10	96	288	256	438	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P43467	7.13e-09	205	322	357	480	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q5ARP5	9.28e-06	173	282	321	439	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004124_00598.