CAZyme Information: MGYG000004121_00043

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004121_00043
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000004121_2|CGC1	79302.28	4.9872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004121	2165228	MAG	United Kingdom	Europe

• Gene Location: Start: 12335; End: 14500 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPDAEQPVMIRVDPGEYCERVEIHRSHVT
IEGETADSVRIVGGLAAQMPSEDGSGQDGKLGTFRTYTVLVDADDVTLANLTIENDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPHGFVFHGCSFT
APDGVAPDSVYLGRPWREWAQTVLIDCWLGRHIKREGWWDWNKPAAHNCVQYAGAILHGP
AGDTTGWVPWANELDVMAAAGYAREQVLAGVDGWDPEGGDGDAVETAELSANGRTVHIET
YCEDEPALRARLKREGRSAAFTGKTPADFETWKIATRTRLYDVLGLSLMDRVPIEIRELS
RVRVAGGIVRTHAMLQVERDVWMPFYLLEPSHPKLDERGLKRCYICPHGHQGAGAASVAG
VAGVPAVDDAVRKFNYDYGLRLARMSYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNVWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPHPLLVQSCEEDHLN
GLRGLKNVDEQLEIVRDAYKLLGRRDGLRHEVCPGEHHLGVAHLAEDIEWLDSHVAECAR
S

Enzyme Prediction     

No EC number prediction in MGYG000004121_00043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	5.5e-78	0.9826388888888888
CE19	463	698	2.6e-24	0.5783132530120482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.36e-61	6	314	81	388	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.24e-50	16	311	10	275	Pectinesterase.
PLN02708	PLN02708	1.42e-41	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	7.95e-41	1	334	7	291	putative pectinesterase
PLN02773	PLN02773	5.02e-40	8	314	7	282	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	719	1	719
ATP54718.1	0.0	1	721	1	721
QUC03567.1	0.0	8	712	7	706
QIX89293.1	7.49e-99	8	336	17	348
QRP39805.1	7.74e-99	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.21e-26	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.04e-26	33	283	55	305	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	3.63e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	6.64e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.89e-23	18	283	18	281	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	1.43e-33	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O81320	8.75e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
Q8L7Q7	1.21e-29	18	324	301	593	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9FJ21	3.09e-29	10	310	262	533	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q43062	1.56e-28	10	310	211	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004121_00043.