CAZyme Information: MGYG000004114_00199

Basic Information

• Species: CAG-95 sp000438155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000438155
• CAZyme ID: MGYG000004114_00199
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000004114_1|CGC9	73164.92	4.9302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004114	2992180	MAG	United Kingdom	Europe

• Gene Location: Start: 235330; End: 237237 Strand: -

Full Sequence      

MDFKDALRSIIKPHNEDPLERLTTPFGEALSKDKVLTEYPRPQFERPSYINLNGLWDYAI
QPKKGFPDRYDGQILVPFSPEAILSGVERQLQPGEYLWYRRLLPVDEMDLFNGSRLILHF
GAIDYEADIFLNGNKVTSHRGGYLPIDCDITDFLEKGENELTVRVSDPSDAGFQSRGKQI
LKRGGIFYTAQSGIWQTVWMEWIPATHIEHITIDPDFDRQEVFIEVDTTLCDALPMLRIC
VMTPDAKQVLFRQSLTPKSNLADVHRHHAQSQSYDFTISIPDELFFPWTPEAPALYPVTV
TLGRDEVKTYFALRTYTIELSEDKPVFCLNHKPCFLMGVLDQGYWSDGLMTAPSDEALLY
DITTMKKLGFNMMRKHLKVESARWYYHCDRLGMIVCQDMINGGGQYRMPFINYLPTVCPS
LARHISDQAYHLFAREDEDARDEWEEELADMIDYLKFFPSIAIWCPFNEGWGQFDSVRIA
ESIRAQDPTRLIDAASGWFDQGAGDFISVHNYFRRLKVAAGEWKKHKKSRAFFLSEYGGF
ACHIDGHSSVERIFGYKRYETKEEFSKAYDTLIKEALLPLREQGLSGAVYTQVSDIEEEV
NGILTYDRKVVKLQLPETLKESRSKEESSESQPSE

Enzyme Prediction     

No EC number prediction in MGYG000004114_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	538	1.6e-96	0.550531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.40e-31	42	492	6	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.87e-21	51	490	14	443	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.80e-18	99	492	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.89e-12	99	396	124	411	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	1.09e-10	52	200	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95236.1	2.02e-222	1	613	1	626
QNM02004.1	5.04e-218	1	613	1	639
ADL32949.1	8.31e-218	1	613	1	627
BCJ97853.1	1.03e-210	4	614	3	586
QHQ59405.1	4.10e-206	1	613	1	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.86e-130	20	613	10	570	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4JKM_A	2.44e-22	45	469	11	415	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6U7J_A	9.78e-22	52	570	24	540	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
5C70_A	5.38e-20	50	496	21	454	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	1.33e-19	50	496	46	479	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.89e-17	98	558	59	475	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	6.26e-17	39	399	43	389	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q6LL68	8.67e-16	99	507	120	494	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
A8AKB8	7.16e-14	107	507	131	500	Beta-galactosidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lacZ PE=3 SV=1
A8GGN3	1.64e-13	99	507	125	499	Beta-galactosidase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004114_00199.