CAZyme Information: MGYG000004111_01783

Basic Information

• Species: Angelakisella sp900547385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Angelakisella; Angelakisella sp900547385
• CAZyme ID: MGYG000004111_01783
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		28190.36	6.4954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004111	1878852	MAG	United Kingdom	Europe

• Gene Location: Start: 4406; End: 5137 Strand: -

Full Sequence      

MYLLSSDLAEGTQQQLCRQVPAAVALHFISVPRELFEDFPETDRYPQEIYYRLAAPLLLP
PELDRILYLDADIVVINPLGPLYRSDFEGNLFMACTHTRELLTRANSHRLGLEKPVPYIN
TGVILMELNGLRQTIDLSAVRQYALEHFDALLLPDQDILTALYGSRVKLLDSQRYNLSDR
ILAFYNANPLHPHHSLEWVRQNTVIIHYCGRNKPWKPGYVGILDVFYRELKEQQTHLHPE
KNR

Enzyme Prediction     

No EC number prediction in MGYG000004111_01783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	216	4.3e-39	0.7431906614785992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.50e-58	2	216	34	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	3.57e-25	37	215	74	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	4.28e-22	2	216	36	245	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK15171	PRK15171	1.06e-13	14	215	74	270	lipopolysaccharide 3-alpha-galactosyltransferase.
cd00505	Glyco_transf_8	1.29e-11	23	216	56	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDX04293.1	6.49e-65	40	233	73	268
ARC85976.1	7.39e-65	29	237	62	272
BAE85862.1	1.97e-64	40	233	87	282
ACL19350.1	1.04e-63	40	233	73	268
AFL99655.1	2.96e-63	29	233	62	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	6.01e-42	1	228	38	265	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1SS9_A	7.22e-14	26	215	59	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	4.05e-12	26	215	59	252	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	1.53e-12	24	215	64	255	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P19817	1.61e-12	14	215	73	270	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
A0A0H2URH2	7.66e-11	2	230	34	247	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P27129	2.91e-10	2	215	61	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P27128	1.09e-08	16	215	79	273	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004111_01783.