CAZyme Information: MGYG000004094_01399

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01399
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000004094_8|CGC2	41114.13	7.7615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 83506; End: 84603 Strand: -

Full Sequence      

MKKQLVLSMLLIGSSLCAANPFSGSMKKGEVEKVCNAVAKWQIANHELVKHNQLDWTNGA
LYRGMTEWGKTSGNQDCYNFVNEIGEKYNWNMWDRVYHADDICVGQAFIEMYRKVGDRRM
LQPTLERAFYVANHPSKAPLLKTDAIGKDERWSWSDALFMAPPVYAALYQITGEKIYLDY
MDSEYKVCVDSLYDKEEHLFYRDCKRIPLKEKNGKKQFWGRGNGWVFGGLPLIIDNLPTG
CASRNYYINLFVEMAEAVKATQCKGGDWRTSLLDPDSYDMPENSCSAFMCYGIAWGIRNG
YLPKKTYGKVLEKGWESLVSAVHANGKLGYIQPVGAAPKAAGYDATDVYGVGAFLLAGSE
IMKGL

Enzyme Prediction     

No EC number prediction in MGYG000004094_01399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	363	2.6e-84	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.01e-89	38	363	5	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.49e-49	43	360	23	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48187.1	2.10e-271	1	365	1	365
QUT45004.1	1.39e-226	1	365	1	365
QRQ49255.1	2.80e-226	1	365	1	365
QDH57430.1	1.22e-223	1	363	1	363
QDO70976.1	4.75e-220	1	363	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.34e-73	40	363	38	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.38e-52	8	365	10	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	9.47e-45	56	365	39	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.04e-76	10	363	13	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.88e-73	32	362	58	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	2.23e-72	40	363	45	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001229	0.874590	0.123362	0.000339	0.000240	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01399.