CAZyme Information: MGYG000004094_01146

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000004094_01146
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000004094_6|CGC2	48147.88	8.7535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004094	3605841	MAG	United Kingdom	Europe

• Gene Location: Start: 48925; End: 50166 Strand: -

Full Sequence      

MKSKKMKKNFRNLLLAGALLFSIQIQSQQTVSTDLPWSVRMVESEMIRCPESWQLDFQPA
LKWDYCHGLELQAVLDVYDTYGNDKYFNYALAYADTMTNADGTIVTYRPTELSLDRINSG
KFYFRIYEQTKEEKYKKALDLLRNQFDNQPRTKEGGFWHKKIYPHQMWLDGIYMASPFYA
EYAYRNNRPQDYQDVIRQFLVIAKHTYDPANDVYRHAWDESSSMPWADKVTGQAPHSWGR
AMGWYAMALVDVLDFIPKHEEKRDSVLMILDRVAGQIKRLQDHKTGLWYQVLDRSGDKGN
YLESSVSTMFVYSLFKAVRKGYLDKRYLEVAEKGYRGIINDFIEVDKNGLVSITQVCAVA
GLGGNPYRSGDYDYYINEKIRSNDAKAVGPFIMASLEWERLCPQARKSLKVIR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	400	4.8e-122	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.29e-128	37	401	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.82e-107	57	401	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77882.1	3.29e-220	17	401	13	396
QDO69177.1	4.25e-220	17	401	13	396
QUT93209.1	2.45e-219	17	401	13	396
ALJ61262.1	2.45e-219	17	401	13	396
QRQ48639.1	1.98e-216	6	401	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.29e-114	63	401	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.56e-88	56	407	32	373	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.46e-88	56	407	22	363	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.77e-21	46	339	48	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	2.12e-20	141	401	169	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.53e-88	56	407	32	373	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.31e-45	174	397	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.31e-45	174	397	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.92e-19	57	352	23	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000884	0.998214	0.000356	0.000199	0.000173	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004094_01146.