CAZyme Information: MGYG000004086_01010

Basic Information

• Species: CAG-594 sp000434835
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-594; CAG-594 sp000434835
• CAZyme ID: MGYG000004086_01010
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000004086_5|CGC2	99267.53	9.501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004086	1173749	MAG	United Kingdom	Europe

• Gene Location: Start: 93028; End: 95589 Strand: -

Full Sequence      

MITDCKLKISKNIKFNKIGKVLDISNETSKKGYVIFLKPIYCKNKKFKFVNEIDIIEGKG
CQIKLLNKKFKVVESIDPNSENFFENINKLTFVGITIFPNSKIRIKNLDVNFNYVFEDEI
SSLFHGDILLLCPGYPSEFNKYAYAFIHSRMQAYKKENLKVDLAVVNENYINKSSISKFE
NIKVVSTGYNDIRKILQNKKYKKILIHFFDEKYAQILDASDLTETEIIIYSHGSDTLYRA
WDRLNAKYFENITEIPEKVYKTFPGKDDLIKRYNEKGNVKFVFVSNWAKNLSEKLIGIKY
NNAYVIPCNIDTDIFKYNEKKSDLRKKIFVIRKYDNLSTYSIDIAVKVVLELSTRKIFDD
LEFSFYGDGNYHDVLLAPLKNFPNVHIYKKFLSHKEIAQVHKENGIGLFPTRFDTQAVSS
CEAAMSGNVVITSNGVGTEEYIHPNIGTYCDTENIKQYADLIEKIYFDEKLFKELSKQTH
DCVAKTCSYNNTIGADLKLIKSKPNIASFKYKKQVNNPILTIAVPSYNVAKFLKAGIHSL
IDNKYSNKLEILIINDGSKDDTAKIGKELEKLTTNGDKSIVKLIDKPNGGHGSTINKGIE
LATGKYFKLMDGDDYFIEKDFLKFIEILEKEDSDIILTNYVADYAIDAVKTPVRNYSFMV
PGVQYHLDNMKHFGYGFEQWGPLLSTSTYKTKILKDANFKIDEHCFYVDMEYNFIGYLNS
KTVIYYPLDIYNYYLGRAGQSVSAESYRRNFKNHEKVTLRLIEEYYKIPKDVSENKKYYL
KNKIIIPLVEAQYYILTQNLKSPKEFRKFNKILKKYPEIYKDDKVSKKRIKIHRFFNGHF
MSLIEFFSWLKNK

Enzyme Prediction     

No EC number prediction in MGYG000004086_01010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	521	644	2.2e-23	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.28e-21	521	642	1	117	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.57e-20	522	638	1	111	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06423	CESA_like	5.57e-17	522	636	1	110	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK10073	PRK10073	8.59e-17	516	647	4	127	putative glycosyl transferase; Provisional
cd06433	GT_2_WfgS_like	4.53e-16	521	736	1	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67183.1	1.40e-194	79	851	88	866
AJC12300.1	6.32e-80	95	502	101	511
QKF06692.1	2.72e-77	119	702	8	588
AKF26417.1	4.27e-64	126	503	13	392
QJS14803.1	4.27e-64	126	503	13	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.47e-13	516	687	3	157	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZDI9	1.40e-12	512	633	2	114	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
P75086	3.65e-12	519	621	6	106	Uncharacterized glycosyltransferase MG025 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) OX=272634 GN=MPN_028 PE=3 SV=1
P71059	4.31e-12	518	723	3	201	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P47271	6.50e-12	519	623	6	108	Uncharacterized glycosyltransferase MG025 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) OX=243273 GN=MG025 PE=3 SV=1
P47306	1.16e-11	520	640	3	123	Uncharacterized glycosyltransferase MG060 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) OX=243273 GN=MG060 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004086_01010.