CAZyme Information: MGYG000004073_00383

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UBA7001
• CAZyme ID: MGYG000004073_00383
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	MGYG000004073_2|CGC1	75717.93	6.1903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004073	1933457	MAG	United Kingdom	Europe

• Gene Location: Start: 142550; End: 144502 Strand: +

Full Sequence      

MSIASNLEKVKYYIKRYGFFSTLKKVLKRILKIKENRKSNQEAYKIWMEKNTPNEDDLKK
QKATKFDYEPKISIVVPLYNTKEVFFKELVDSLNNQTYLNWELCLADGSPQKNEVLEKYY
KENNKIKYKFLGKNEGISENTNEAINMATGDYIGFMDHDDILANEALFQVVKVINEDLKT
DFIYTDEDKIDENYERFEPYFKPDYSPETLECNNYITHFVVVKKDIIEKVGKLNSKFNGA
QDFDFVLRATKQAEKIIHISKILYHWRVHRNSTAYIADAKEYAFEAGKKAIEEDLKKQGK
TAIVEAGQEVPGIYKIKYDVIGNPKVSILIPNKDNIKLLKKCITSILKLTTYENYEIDII
ENNSEKIETFEYYKEIIKNSKIKILNFNKNTVLDINGEKSLENKILNKDLAENLESNAEK
NIEQVIENTESEEKNLQKNSEFNYSALINFGVRNVDGEFVLQLNNDTNLLTKDWLELFIG
YAQDSQIGAIGARLYYEDKTIQHAGIIVGVSGIAGNALVNLPYGKHAYYGREAATRNVLA
VTGACLFARRSLYFEVGLMDEENFKVAFNDVDFCLKLYEKGYRNVYNPYVELIHYESKSR
GYEFSKEKEDRFVKESNNFKQKWSKYIEYDPYYNKNLSRKTVNYDIAEVN

Enzyme Prediction     

No EC number prediction in MGYG000004073_00383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	73	230	5.4e-25	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.13e-100	70	268	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	8.94e-29	73	273	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	5.04e-26	328	596	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.18e-22	73	227	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.81e-17	74	259	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE14040.1	1.21e-178	7	649	373	962
QIB58022.1	7.23e-171	7	646	20	604
QMW77454.1	7.23e-171	7	646	20	604
AWB09765.1	1.11e-170	5	638	161	751
CDM69534.1	1.42e-170	5	638	184	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.91e-09	72	162	7	97	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	3.38e-07	70	165	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.55e-108	70	638	366	889	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.15e-80	44	638	293	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	2.65e-14	70	268	8	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q48214	1.04e-11	72	252	2	184	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
Q0P9C6	1.27e-10	70	280	2	214	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004073_00383.