CAZyme Information: MGYG000004057_00396

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus
• CAZyme ID: MGYG000004057_00396
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000004057_73|CGC1	63862.08	6.9331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004057	1197031	MAG	United Kingdom	Europe

• Gene Location: Start: 2357; End: 3958 Strand: -

Full Sequence      

MPYPDEQAIKKLHLSDAEIEKVVMQYDLICTAPQDTKELGQGATVYEHYKRSPYHRIKDF
DLVLSIIRDKYPEFVDATRKYINGHTAYFCNMYIMKKNIFHEYSKWLFDILEEHEKRTNF
NDYDIDEYRVSGFLAERLWGIYYTWLKENREYKILETQRSFFTNTEENEAILPAFEKGNI
PVVLAADNKYVPYVTTLLRSIIDNANQEKNYDFVILNSNISDLNKEKIKREFVQSTNMSI
RFANVKRLFAKYDLYVHRHFTVEIYYRLFMQDIMKHYDKVIYLDSDIIMLDDVSKLYDIE
LGDNYLAAVQDVDSAGCYNGVDSERKKYHAEYMKMKNPYDYFNSGVLVMNLVEFRRNFTA
EHILELAASKKWLFPDQDVLNILCEGKVHYLDMSWNVMMNWKNDTSCRIETAKRAPYWLY
LKYLKSRKEPKIVHYAGFQKPWDTPDCDYAEYFWKYAKETSVYEKLIAKEKEKTLAFENE
NVNDPYLLHINGLDEPLYIDGLYIKMINKLNKWFPKNSSKREKMKRVVKHFVH

Enzyme Prediction     

No EC number prediction in MGYG000004057_00396.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	178	444	6.7e-61	0.8832684824902723
GT111	9	143	1.9e-36	0.5898617511520737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.17e-71	180	444	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.55e-39	181	442	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
pfam14393	DUF4422	1.23e-37	9	144	88	217	Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.
COG1442	RfaJ	4.94e-36	180	475	3	278	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	2.15e-28	182	443	4	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK94470.1	6.20e-128	9	469	112	572
QRT50573.1	2.45e-126	5	528	103	608
VEG44624.1	8.13e-113	3	469	488	956
BAJ70033.1	8.13e-113	3	469	488	956
ACJ53440.1	8.13e-113	3	469	488	956

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	1.85e-82	2	453	126	579	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.07e-21	182	447	3	256	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	5.47e-20	182	447	3	256	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
3TZT_A	1.44e-13	182	442	8	252	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVW_A	2.19e-09	182	457	8	251	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	9.19e-19	182	444	9	257	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URH2	2.03e-18	182	444	5	231	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
A0A0H2URA3	7.42e-14	182	456	6	250	Glycosyltransferase GlyB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyB PE=3 SV=1
P19817	4.61e-13	264	477	106	305	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P43974	1.95e-11	182	442	41	278	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004057_00396.