CAZyme Information: MGYG000004053_00139

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_00139
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000004053_2|CGC1	88601.22	9.0943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 58823; End: 61195 Strand: -

Full Sequence      

MKKLAIITALALSLATTAATAAENKFTPIKESPAIWANVPQSLKSAKWLWRAYPYEAYEI
VNVYCLGRRTFDLESVPRKAPIFITADQSYRLFINGKFVCSGPARGYQFSQPFDEIDVAK
YLQKGRNVIAVRAYNAGRSTFSYLTQGYAGFIFALELGGGRNIVSDTATKVRTQEGCDRN
TAQLSIQMNNQEHIDLRVENPDWIQTGFDDSSWGKPSSRPYNAMPYYSMESRMIPMLEEF
EMKPEALVSRGSGKSVSNGERVFDVAKLFVAENIPHTVKTESVFEVEAKPSKDGVSSFVF
DMGRMCVGMPILEIDGAKGGEIVDMLATELLKDGTGNPVGGSKIAAANRIICRAGKQRHM
FFNPFGVRYITVRVRNNPDSTIKVKPSLMWSAYPLADKGKFKTSNAYVDKIWQACKQTQK
ICALDAYVDTPYREQAQWWGDARVQSWNTFFISGDARLLRRGIRSISMQKVPNGLTYGHA
PTSSHHCILPDFSLTWILTLYDYYWQTGSIEAYLSHRDTVASILSYFDGMTDPETGLVKA
DNRYWLFLDWTNIQKIGQPAILNLWLLEALEKMQKLCTDNAISGDAKMYAERAAKVRAAI
EKNLVKKDGLISDGILPDGSQNTESSIHAQVLGKMTGIKGLDFEKAKREMLLPFLGGKKK
FKAMPSSFWVVYVLELVADEGHGAEVYDYIKRNWREFAEYGTTFENFDGRASHSHAWSAH
PAFLLPRILGGIRQKAPAWTEVSFKPNFFEDFAEITYPTPQGDIKVSWRKNADGKFSSTV
DAPKGISVSK

Enzyme Prediction     

No EC number prediction in MGYG000004053_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	297	787	6.8e-86	0.9742063492063492
CBM67	46	217	8e-37	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.71e-16	396	729	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.65e-11	77	213	3	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.43e-07	731	783	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	4.12e-06	452	602	56	208	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam05592	Bac_rhamnosid	7.55e-06	292	385	4	95	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT92885.1	3.38e-221	38	786	2	756
SDU02729.1	5.22e-219	48	786	18	766
QYY35421.1	3.37e-216	40	786	11	761
AHF89243.1	2.45e-214	46	788	19	792
QYM78626.1	4.05e-204	37	788	7	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.73e-47	45	788	7	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	7.16e-18	387	766	290	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.41e-06	195	783	326	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999094	0.000158	0.000175	0.000159	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004053_00139.