CAZyme Information: MGYG000004050_01006

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004050_01006
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000004050_27|CGC1	55927.93	5.1497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004050	2129816	MAG	United Kingdom	Europe

• Gene Location: Start: 1998; End: 3449 Strand: -

Full Sequence      

MLKKLILLPMLCCSMLAVSAQETLPWENGKLMVSDEGRYLRHENGKPFFWLGDTGWLMPE
RLNRDEVEYYLQTCRNAGYNVVQVQTVNGVPAMNVYGQYSMTDGFNFEDIDRPGVYGYWD
HMDYIIKTAEKNGIYIGMVCIWGGLVRSGLMDESQARQYGEFLAGRYKDSPNIVWIIGGD
TRGNVNREVWETLARTIRSIDKNHLMTFHPFGRTASATWFNDAEWLDFNMFQSGHRRYGQ
QEDDGDYTLPRHHEEENWRYVEYCQSMKPMKPVIDGEPVYEGIPQGLHDPEEPRWTAADV
RRYAYWSVFAGAFGHTYGNNSIMQFYRPGIVPAYGATESWWDALKDPGYNQMKYLKELIL
RFPFFERIPDQSVIAGENGERYDYAVATRGKDYLLVYNHTGRPMNIDLTKISGSRKNVWW
YNPKYGEYSYVGEFENKVTFFFDDLAYGRGEDRVLVAVDSSKDYIAVGRKGIVSESVSVQ
VPD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	29	455	1.8e-167	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	5.81e-156	37	362	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	6.34e-42	368	457	1	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37166.1	1.15e-255	13	465	15	467
QUT77834.1	1.52e-255	22	465	30	476
ABR40296.1	1.02e-254	10	465	13	473
QQY40475.1	1.02e-254	10	465	13	473
QEW37289.1	1.02e-254	10	465	13	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.12e-251	24	465	11	452	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.85e-243	20	465	20	468	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	1.56e-239	24	465	11	452	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001100	0.960228	0.037683	0.000364	0.000315	0.000283

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004050_01006.