CAZyme Information: MGYG000004021_01498

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_01498
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000004021_17|CGC1	46997.94	7.5901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 14617; End: 15846 Strand: +

Full Sequence      

MKKTFKIVLFTALAIGCCGSIDAKKKQKFEVDPDLPMSIRMTQSEIIRNPEGWMLDFSKG
LKWNYCHGLECQSFLDVHDHYIDNKKYAKIVAPFYTYVKEFADTIINEKGIIYGYKKSNY
NLDHVNPGKILFRLYEREQDPRYKIAMDTLRSQLASQPRTSEGGFWHKRVYPFQMWLDGI
YMGEPYYAQYTATFDADNEAAYADIVNQFLLVAKRTYDKETGLYRHAWDEIKALPWSDKS
GRSAHVWGRALGWYMMAIVDALDYLPQDQPGRDKIITILQGIVKNLAKYQDPQTGAWCQV
IDQTGREGNYLEMSCTPMYAYAIAKGVRKGYLDPSTLEMAKKAYQGILDNFIKVDEKGLV
SLTRVCGVAGLGGKPYRDGSFEYYINEVIRDNDPKGVAPFIMLCIEMND

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	407	3.4e-115	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.16e-112	40	407	4	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.15e-94	97	407	60	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT77714.1	1.39e-151	1	406	1	393
QUU07653.1	1.39e-151	1	406	1	393
ASM65740.1	1.39e-151	1	406	1	393
QRP57042.1	1.39e-151	1	406	1	393
BCA48645.1	2.71e-150	30	406	11	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.79e-103	63	406	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.04e-73	94	407	62	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.94e-72	94	407	52	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	7.46e-22	159	384	183	389	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	9.57e-17	134	378	103	348	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.85e-72	94	407	62	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.73e-36	182	406	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.73e-36	182	406	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	4.93e-08	176	347	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000006	0.003232	0.996804	0.000001	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_01498.