CAZyme Information: MGYG000004017_01537

Basic Information

• Species: HGM11588 sp900754755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588; HGM11588 sp900754755
• CAZyme ID: MGYG000004017_01537
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000004017_31|CGC1	97276.49	5.493

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004017	3620670	MAG	United Kingdom	Europe

• Gene Location: Start: 23651; End: 26209 Strand: +

Full Sequence      

MKLLLDGVWQGTGFGPEGETFSFEAAVPGCVHTDMLRCGKIPDPYWRDQAQCARWIENWN
WSFERTFVVEQVPTAAQLCFEGLDTYCRIYLNGIEIGRAENMFIPHTFPARGLKAGENTL
RVVFLSPIAATRGLPERPAAFTAERLYTRRLQCTYSWDWVERFVTMGIYRSAYLFWAEHC
VIDDLRCETRVVDDFGALLFCHVEFRHMSDADFCRITLTDPDGNVVFQKRRRIVEDGLSE
MIDVPQPQLWWPNGYGDQPLYRLCARVETAEGAVLAERTLNMGIRTVRILQAPDLPGSPE
AQKCQALQKGAHVSDKNARWDQNREGDFAGFTLIVNGVKIFCKGANWVPCEPFPSAETPQ
KIRALLRQLQLAHGNMVRIWGGGLFEQDAFYDACDELGLMVTQDFLMACGHYPEWEDGFL
RQLTVEARYAARRLRNHPCLVWWSGDNENAMDADEDMADYHGRRSALRAIGPVLEEMDPN
RPFLPSSPYGGRPYGSITRGTTHNTNYMGEKFSYIRFHDMRDYRAYFSEYLSRFCAEEPC
MGMPSVCSMRRFLAEDDIFGPDDSMLRFHTKNNPSPEFQEFEVFDYTVAAAEKLLGADKC
PEDRVMKLQYIQYEWIRITMELYRRNKWFSSGLIYWMLNDCWPASGCAILDYYARPKAAW
YGFRRAAQPVIASIDFTNGQYHLYVCNDGRKPCDGVARLFLQPFDKVEPTRELCAEFHVR
PNESAPVLSAALPATRKGEILLAEIQGPGFRDRAYFFENRPCDCQFPGVPPAVKQVSSDS
ITLRASAYVHAVSLDGEMVFEDNFFSLLPGETRTIHFSGAGEEIRMRVLHSAAPDIAIRR
SPFAGPERDSTG

Enzyme Prediction     

No EC number prediction in MGYG000004017_01537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	683	3.7e-78	0.6289893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.16e-58	19	670	26	632	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.43e-09	57	481	107	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.75e-09	182	285	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.10e-07	767	818	2	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK09525	lacZ	7.41e-04	167	289	208	338	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI36571.1	1.04e-219	3	817	5	832
QJD84958.1	6.00e-213	3	817	5	832
QNF27299.1	9.18e-112	19	833	29	829
ACM59377.1	2.32e-110	1	705	1	660
ATY86402.1	4.90e-110	9	840	10	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.41e-95	3	817	27	810	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	3.17e-90	3	830	9	833	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.30e-90	3	830	11	835	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.36e-90	3	830	11	835	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	8.61e-90	3	830	9	833	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	5.13e-83	27	674	32	660	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	2.36e-80	25	819	30	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	1.16e-78	27	674	32	660	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
I2C092	4.93e-78	5	830	9	851	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A1D911	5.77e-78	27	674	32	660	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004017_01537.