CAZyme Information: MGYG000004006_01843

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_01843
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	MGYG000004006_8|CGC1	83153.04	5.5873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 34904; End: 37138 Strand: +

Full Sequence      

MISLRKIYAAAAALGFAATASAIEIHVSPAGNDSNPGTREAPVATLRAAQQCVRHYKSIW
HQPETITVVIAAGNYELDEPLVFNGLDSGDPDHPVVWQAAPGARVSLCGGVNIPGSAFGR
VKDPAIRRRLNPKAASHIVCADLRALGIDSFGEIVQYGHSASVPVAPLELFFDGEPMELA
RYPNEGWIRIGEVLDPGSSPRVGDYSDRPGVFRYTDDRHAAWAGLKDVWLQGTFNYGFAD
DNIRVASIDPGKGTVTLASPHLYGIASGAAYQHYFAYNILEELDRPSEWYLDRESGILYF
YPPSDIRKANIQVSILEDPIVCLEGVEYLRLERLTIECGRGIGVYIERSNHNVIAGCTIR
NVGTSGVFMGQGAEQTFPHITVDDYEGRPVSRRIGNLQGHIYKYPHWDRKAGMHNGILSC
DIYNTGSGAVYLSGGDKVSLTPGNSYVENCRMTNYNRRNKFLWAAVSVNGCGNRVSHCEI
HDSDWQGIYVSGNEHLFEYNYIHDVTLNSNDTSPWYIGRDPSSRGNIVRYNRFERCGNPE
RMNMGIYCDDSSTDVLVYGNLFVDMNTTHGVMFSNTGWDLKFVNNIVVNPVASTMYISSH
YYTWARDQGPACFGENGLLRYRLTQCVDIYSAPYSDRYPELMNYLDPIVEGQEWEGMRPR
RNCMTRNLIVGSREAPLKLDGPHAQGTETNNFCTQDDPGFVDWKGGDYRLKPDAEAYRRI
EGFEPLPIERMGVYEDEYRKTDNR

Enzyme Prediction     

No EC number prediction in MGYG000004006_01843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	24	318	6.9e-35	0.49146110056925996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	7.16e-14	410	585	6	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.38e-08	321	493	3	147	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd14251	PL-6	1.63e-05	448	540	97	209	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam05048	NosD	0.001	424	604	8	189	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam14592	Chondroitinas_B	0.009	444	570	99	238	Chondroitinase B. This family includes chondroitinases. These enzymes cleave the glycosaminoglycan dermatan sulfate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK56945.1	2.07e-154	2	739	17	737
QUH28384.1	6.21e-124	21	743	36	736
AUP78440.1	1.65e-105	24	733	26	682
QUT84604.1	2.59e-98	169	732	179	719
AWN48906.1	1.02e-38	9	689	8	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.05e-09	21	335	23	323	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000469	0.998703	0.000178	0.000249	0.000209	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_01843.