CAZyme Information: MGYG000004006_01178

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_01178
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MGYG000004006_4|CGC2	95262.86	5.5743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 121399; End: 123924 Strand: -

Full Sequence      

MNRNLKLLFWLGMLTVSLESAAAREFNGVYEGHNMDHVAFPVGGIGTGMICFEGTGAISH
VSLHHVPDLFHEPCTFAAICVKGVENGSKVLEANVPEYKKYGRLNGGMGVGGTTWGLPRF
DEGRFSARFPFAQLDLHDNDLPLDVSIVAWNPFIPNDEDNSGLPVGGFEYTFRNTSKEPV
EAVFSFNTRNFMYKTNAAVSSVTPFERGFILNQEAPANERHLEGHFAIWTDDARTTVDHC
WFRGGWFDPLTMAWNNVTRGELISNEPGPGAPGGSLYVPINLAPGESKTVRLYMAWFVPR
SNHRIGPDPKNVRDFGSCYNEADYAGQPDFYEPWYSRKFRNVNEVAAYWEENYDQLKQRT
SRFTEAFYDTNLPKEVVEAVAANLTILKSPTVMRQHDGRFWVWEGSGDSWGSCHGSCTHV
WNYAQAVPHLFPRLERSLRETEFFVDQNTDGHQAFRANLPIRPVHHDFHAAADGQLGGII
KVYRDWRIGGDSLWISRLYPQLKQSMDYCIRTWDPREVGALEEPHHNTYDIEFWGPDGMC
TSFYAGALNCFVAIGEYLGQDVSYYRELLGRSRDYMENKLWNGEYFIQNVRWKDLNAQDP
TTALTFHSTYSEEARVILEKEGPKYQYGTGCISDGIIGCWMSLAAGIDEPIDPDMVRSHL
NAVYRYNLKHDLTDHANPQRPGYAMGREGGLLLCSWPHGNKPQLPFVYSDEVWTGIEYQV
AAHLIFEGEVEKGLDIVRTCRSRYDGTVRNPFNEYECGSWYARAMSSYSLIQALTGVRYD
AVEKTLYIDSRIGDFRSFLSVDGGYATVSLKRGKPCIKVYEGQIDIDKCLVGGKSVEIER
L

Enzyme Prediction     

No EC number prediction in MGYG000004006_01178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	398	770	6.3e-57	0.9944903581267218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	7.35e-66	398	770	1	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam12215	Glyco_hydr_116N	5.65e-54	39	356	1	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
COG4354	COG4354	2.02e-31	41	778	16	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT37400.1	0.0	5	839	1	848
QBJ18460.1	0.0	5	839	1	848
QDO68263.1	0.0	25	839	30	847
QUT60790.1	0.0	19	838	23	851
QQA29305.1	0.0	19	838	23	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJS_A	5.00e-08	41	761	55	754	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	5.03e-08	41	761	58	757	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	5.04e-08	41	761	59	758	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	5.04e-08	41	761	59	758	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKW_A	5.04e-08	41	761	59	758	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZF3	5.27e-17	41	740	144	839	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q5M868	6.20e-16	41	740	144	839	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	9.70e-15	41	740	153	848	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	5.71e-08	481	732	678	890	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999123	0.000182	0.000149	0.000143	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_01178.