CAZyme Information: MGYG000003997_01161

Basic Information

• Species: HGM12650 sp900761725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650; HGM12650 sp900761725
• CAZyme ID: MGYG000003997_01161
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000003997_8|CGC1	49768.22	6.2455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003997	1773221	MAG	United Kingdom	Europe

• Gene Location: Start: 60530; End: 61852 Strand: -

Full Sequence      

MGKITFMGAGSSVFAKNVLGDVMLTPALRDFEIALYDIDPQRMEDSYLMVTALNRNINEN
RAKITKYLGVENRRDALRGADFVVNAIQVGLYKPCTVTDFEVPKKYGLRQTIGDTLGIGG
IFRALRTIPVLEDFAEDMTAVCPNAYFLNYTNPMAMLSGFMQRYTDVKTVGLCHSVQVCS
SGLLRNLGIAPKQPIREKIAGINHMAWLLEIEDADGNDLYPEIRRRANDFLNNPPDYFKD
LTRYEYIRRLGYYVTESSEHNSEYNAFFIKSAHPELITKYKIPLDEYPRRCIRHIEKWDE
ERIKYVNNKVSHSRTREYASRIMEAIVTDIPCKIGGNVINTGLITNLPSEACVEVPCLVN
KLGIQPTYVGALPTQLAAMNITNINVQLLTIEAAVTKKKETIYQAAMMDPHTSAELSIDD
IVSLCDDLIEAHKGWLPEYH

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	183	2.4e-62	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	3	429	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	440	1	431	alpha-galactosidase; Provisional
COG1486	CelF	2.76e-169	1	440	3	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	3.93e-67	3	189	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	3.10e-65	3	436	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH01412.1	7.26e-220	3	440	2	440
AJH01932.1	2.41e-218	3	440	2	440
QIB56181.1	4.86e-218	1	439	1	439
QMW81085.1	4.86e-218	1	439	1	439
QUN34579.1	2.90e-217	3	440	2	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	6.65e-35	3	439	6	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	5.50e-32	3	439	9	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3FEF_A	1.28e-30	3	430	7	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1U8X_X	5.08e-29	7	438	33	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	8.48e-26	3	440	8	443	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	6.38e-189	1	439	1	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	4.29e-142	3	437	6	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	3.97e-140	3	439	6	448	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	1.38e-61	3	439	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
Q9AI65	7.57e-43	3	436	4	449	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003997_01161.