CAZyme Information: MGYG000003994_00844

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_00844
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		61301.33	8.0684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 12946; End: 14616 Strand: +

Full Sequence      

MKAITLFSGLLLLATSLPLQAQYPTVPDSVKQRIARENAYNEKLSEAAWKKALKVVKKEE
KKYGRVYRPWASKPEDLPQCSIPAFPGAEGGGAFTAGGRGGKVITVTSLADRGPGTLREA
CETGGARIVVFNVAGVIELQSPISIKAPYITIAGQTAPGDGVCVTGASFLIDTHDVIIRH
MRFRRGAVDVGNRDDALGGNAVGNIILDHISASWGLDEVMSIYRHVWNRDETGKGTKLPT
VNITIQNSMFAEALDTYNHGFGATIGGHNCYFARNLFASNISRNCSIGMNGGFNLVNCVV
YNWWNRSIDGGDEYTQYNIINNYFKPGPITALQNGRPIQYRILKPDASRDKNKPDTYGKA
YVNGNIMLGNDRVTADNWDGGVQCGKFADAIRVDQPFAMPMHNPIMSAQEAYEFVMENVG
ATLPKRDTVDARIVLTVRTGQAIYDKKAKPFTTPYVKRRLPDDSYKYGIITHPQQVGGLP
EYKGTPYIDSDLDGMPDEWEIRYGLNPNDPSDAIKDCNGDGYTNIEKYINGIDPTRKIDW
TDPKNNHDTLQTRLQK

Enzyme Prediction     

No EC number prediction in MGYG000003994_00844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	134	324	3.2e-63	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	0.004	95	327	48	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68105.1	9.85e-294	6	553	7	556
QJR55559.1	9.85e-294	6	553	7	556
AII69027.1	9.85e-294	6	553	7	556
ALA74794.1	9.85e-294	6	553	7	556
AII63047.1	9.85e-294	6	553	7	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	2.68e-06	89	303	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	5.30e-51	81	535	19	416	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q0CLG7	1.42e-50	81	535	19	416	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B0XMA2	7.54e-50	81	535	20	417	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.05e-49	81	535	20	417	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	1.98e-49	81	535	19	416	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.999005	0.000182	0.000181	0.000158	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003994_00844.