CAZyme Information: MGYG000003992_01737

Basic Information

• Species: 43-108 sp001915545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; 43-108; 43-108 sp001915545
• CAZyme ID: MGYG000003992_01737
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000003992_23|CGC1	87910.71	4.6009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003992	3355495	MAG	United Kingdom	Europe

• Gene Location: Start: 6363; End: 8786 Strand: +

Full Sequence      

MGKYPLNLILGAMGLLSTVNLAAQPQYDYSNMQREKLDRGVVAVKSGNSVFVSWRFFDTD
PEDTQFEVWRNGIKKASSVRTSSNYRDSSGSAGDEYFVVAKRGNGEGMDTSKVVKAWSDV
YMTVDIDRPALVKMNGSEVTYSPNDCSVGDVDADGEYEIILKWEPSNSQDNSKGGKTANV
YFDCYKLDGTKLWRIDMGQNIRAGAHYTQFMVYDLDGDGMAEMACKTAPGTVDGKGHYVS
EAGVTEDIRTVDNSRAYANSGGWILNGPEFLTVFSGKTGEALTTIDYYPSRGITTNDPSS
SALDQIWGDNYGNRCDRYLACVAYLDGKKPSLVMCRGYYTRAYLVAYDFDGKQLVERWKY
NSIKSGSNELYGQGNHNLSVADVDGDGCDEIIYGSAALDHDGTFLHSTRRGHGDAIHVGD
LDPDRPGLEIFQVHESSPYGFTLRDARTGEILVEKSASGDTGRGVAADVSAVTRGAEMWS
SANDDVYSVNGDVAGQGKPSCNFRIFWDGDVLEEVLDGTKLDKYGSGRLMTFYNYGASTA
CNGTKNTPCLQADILGDWREEVILYNSDCTKLNIFTTTTPTEYRVPTLMQDHIYRMGVVW
QNVAYNQPPHLGYYLPDSVKAAIYHVGGPLEQQAVVGDSIEEIRFKMKGGTAVALYSRGL
PTGVTIKKDTKDELGLTYVVSGVPKVAKSCDFEVYSSGGAESASVFGRIDVSVSDGIGAV
ESSDDEWISLSSTYFDNSISMELNMSNSDKITVSLFASSGSKVAEKSFGASCGEGCVMNG
LEGLSSGMYILRADNGSEVRTFKVVKK

Enzyme Prediction     

EC	4.2.2.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	33	620	1.3e-247	0.9811320754716981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	35	613	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	3.46e-26	33	117	2	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
TIGR04183	Por_Secre_tail	2.74e-05	743	807	13	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73808.1	7.96e-231	34	711	25	710
AGB28791.1	1.04e-226	1	617	1	646
ADL25062.1	7.51e-226	33	699	23	684
ACX75592.1	7.51e-226	33	699	23	684
AEE95353.1	5.37e-219	29	621	35	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	5.88e-209	33	620	10	580	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	4.52e-207	33	619	4	572	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	1.07e-196	33	631	7	609	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	6.69e-206	33	619	41	609	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	4.48e-196	33	631	7	609	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000497	0.998744	0.000197	0.000200	0.000165	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003992_01737.