CAZyme Information: MGYG000003991_00384

Basic Information

• Species: RC9 sp001915575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp001915575
• CAZyme ID: MGYG000003991_00384
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		40821.83	4.4751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003991	1819700	MAG	United Kingdom	Europe

• Gene Location: Start: 84019; End: 85122 Strand: -

Full Sequence      

MSNYLKSAVTALAMAASVLTCSAQGARGAAPLKSTVVNPDGTVTFNYRNDNASDVKVDVQ
FAGRHDMHRGGDGVWTVTLGPAEPDMYPYCFIVDGVSVMDPLNPDWFPNEGFKNSILDIR
GDTPLIHSAQDVPHGAVDYVTYWSQTLGLFANAIVYTPAGYDSHPEKNYPVFYLISGTTD
TEEVYFKVGRVNFILDNLIAAGQAEEMIVVLPYGNPSKYYPAGTDLRGRGDMFSADLIDD
LMPYVEKNYRTIADRDHRAIGGFSRGGNQALANGLRNLDKFSWLCSYSSFTTMDLPAYDD
PDINELVNLFWLGVGTDDFLYADAKDYMDFLDSKGIENVKVFTDDKFGHTWMNARYFLDK
SLRLLFK

Enzyme Prediction     

No EC number prediction in MGYG000003991_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	145	363	1.6e-44	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11294	E_set_Esterase_like_N	1.08e-26	41	119	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	2.23e-26	95	367	25	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd02858	E_set_Esterase_N	5.25e-12	41	101	1	60	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	5.43e-11	144	290	1	144	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	3.21e-08	155	289	27	170	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF34828.1	2.02e-114	34	367	34	386
QMU27121.1	4.64e-113	18	367	14	386
QHW01484.1	1.44e-112	34	367	26	378
QKZ14159.1	1.64e-112	17	367	9	382
AXY74120.1	2.65e-112	34	367	34	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	6.78e-51	25	367	15	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	4.11e-48	43	367	48	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	2.66e-45	37	367	21	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	4.35e-45	37	367	42	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	1.22e-39	37	367	19	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	7.95e-38	37	367	331	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	6.00e-31	35	318	41	340	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	2.16e-30	36	367	396	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	1.47e-26	132	339	46	251	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	4.45e-06	109	288	157	318	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000508	0.421441	0.577459	0.000223	0.000181	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003991_00384.