CAZyme Information: MGYG000003989_01609

Basic Information

• Species: Alistipes sp002161445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002161445
• CAZyme ID: MGYG000003989_01609
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000003989_145|CGC1	31880.23	5.5753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003989	2451831	MAG	United Kingdom	Europe

• Gene Location: Start: 1307; End: 2152 Strand: +

Full Sequence      

MKHLLILAATLCLAAPLTARSRLETVTLHSELLNADKSCTVYLPDGYDRDTTRRYPVLYL
LHGASDTHTAWVEKGNMQQIADEAFAAGLAAPMVIVMPDASGEGENHTGIHMGYFDVPGW
PYERFFFEELLPEMEQRYRILGDKRHRAIAGLSMGGGGTAVYALRHPELFGSACTMSGLL
DIFPSPRNYDNDFQRSVVENSPVARLRGMSDAELEAVRTVRWWVDCGDDDFLWRCNLDFY
ALMRERNVPIQYRMRDGGHSWRYWQKVLPDALTFFSIGFGE

Enzyme Prediction     

No EC number prediction in MGYG000003989_01609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	30	275	2.7e-62	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	9.31e-39	3	280	2	313	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.52e-32	30	275	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	3.11e-30	18	275	64	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	9.52e-08	122	269	90	224	Esterase/lipase superfamily enzyme [General function prediction only].
PLN02442	PLN02442	1.88e-07	29	261	24	263	S-formylglutathione hydrolase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW91289.1	1.04e-35	23	268	139	381
QQA30430.1	1.71e-34	29	268	154	389
QUT61959.1	1.71e-34	29	268	154	389
QMI79541.1	1.71e-34	29	268	154	389
QUT65236.1	4.62e-34	29	268	154	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.40e-79	15	281	4	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	2.01e-31	30	270	139	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	7.71e-23	22	156	138	275	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
4RGY_A	1.10e-22	30	277	11	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
1JJF_A	2.00e-22	20	272	29	254	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.50e-20	20	272	48	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	2.53e-20	41	272	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	7.21e-19	23	178	500	654	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.40e-15	19	179	139	305	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P23553	2.28e-10	26	276	6	262	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000846	0.998382	0.000261	0.000172	0.000162	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003989_01609.