CAZyme Information: MGYG000003985_00381

Basic Information

• Species: CAG-873 sp002493945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp002493945
• CAZyme ID: MGYG000003985_00381
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	MGYG000003985_42|CGC1	63093.15	5.4483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003985	2303173	MAG	United Kingdom	Europe

• Gene Location: Start: 7154; End: 8896 Strand: -

Full Sequence      

MVVPYVRELQKNGVAACVKHYALNNQESRRHTTDVDLSDRALYEIYLPAFKAAVQDGGAW
SVMSSYNLYKGRHACQNPRLLKDILRDEWGFDGAVISDWGGVHDTEQAVTGGLDLEFGSW
TNGLSEGKKNAYDSYYLADPYLKLIAEGKADTRELDVKAANVLRLMFRTAMNPDKPYGSL
NSPEHVAAARRIAGEGIVLLKNDRGVLPLDMRGKKKIAVIGENAIKPMTVGGGSSSLKVR
EEVSPLEGLKRRFGKEADVVYARGYVGEQLKEHDGMALLDLTDSRTESELIAEAVSVARD
ADYVIFVGGLNKNPHQDCEDSDRAGLGLPYGQDRLIAELAKANPDIIVVNISGNAVAMPW
VADVAAVLQGWYSGSEAGNAIADVISGDVVPSGKLPFTFPARLEDVGAHAVGEYPGNAEA
LKLGADTVPEYYSEDIFVGYRYADKAKTAPLFPFGHGLSYTTFAYGKPEADSRRLGADGS
ITFSVKVKNTGRTAGKETVQLYIADKKSSLPRPPKELKGFRKIELAPGEEKVVTFTVGRD
ELSYYDDSKHAWVAEPGTFEALFGSSSRDIRGSLTFTLVD

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	116	3.3e-38	0.5555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.12e-113	14	578	203	764	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	1.34e-69	197	440	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.36e-46	14	556	210	753	Probable beta-xylosidase; Provisional
COG1472	BglX	1.69e-46	1	256	148	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam14310	Fn3-like	1.31e-30	497	567	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH53752.1	3.60e-304	1	578	168	749
QGT72794.1	3.60e-304	1	578	168	749
QUT31969.1	3.98e-304	1	578	161	742
QUT26551.1	3.98e-304	1	578	161	742
CBK67614.1	4.76e-304	1	578	166	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.99e-117	5	570	138	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.76e-93	6	578	140	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.34e-87	6	570	133	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.01e-84	6	570	133	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
6R5I_A	2.42e-84	12	579	169	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	2.88e-206	3	579	178	746	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	2.19e-116	5	570	138	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	2.02e-105	3	578	127	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	2.19e-102	5	578	137	838	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
Q5BB53	2.05e-93	9	559	136	812	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003985_00381.