CAZyme Information: MGYG000003985_00036

Basic Information

• Species: CAG-873 sp002493945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp002493945
• CAZyme ID: MGYG000003985_00036
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924		99194.83	4.8245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003985	2303173	MAG	United Kingdom	Europe

• Gene Location: Start: 2093; End: 4867 Strand: +

Full Sequence      

MTVAKLFITIMTLSAAHAACLGAVSTVERVTSPLTVAQGDDLHISAADEAIAQGAVVDMS
GDDCRLFFDNIRPGDVIERYSGSVTVKGEKLEPDINARIRVYLHGTEILPHSAGFTPLEA
RSLSGKSERYVQGRFYTNSPAADVTEASPLALDDDIHSISLARGYMATLATAPDGTGYSR
CFIAENENLYIDALPRELDGKVSFIRVLPWKQVSKKGWVGGNSKTDPPEGYFEEQADALL
TTWAYNWGTSADYGRSPEAKGTPWRNQEFVAEKWGAGGDSDWRRIAADYDLTHLLSYNEP
DHGEQSNVTVERAVEEWPRHLATGLRLGSPATTDFAWLYRFMDECRSRNYRVDFVAIHAY
WGGRGSSVQVSSVRDWYKKLKEVHDRTGCPLWITEWNNGANWTHETWPSDKAAQQEKQRR
FMEEVLEMMDTCTFIERYSVYNWVEEKRSMFWGNLNLTPAGKVYRDFKAAPAFSRQAEVI
PGWNVSSAATASIGYRGGASFELTWTDDNLEQVDGYTVERSVASGAWTDIADCPAGTASY
VLTTDRTPGADIAYRVVSVVDGRDAARSNQASYANMPAAEATPLVGRAVTGKGLTHYLYP
LRTVTDPVLVAGVQTWRMKSPMTVMARLIDSDVCAFGPESWTYNATDAFVSRDTLPYMVF
PAPGTYDCGGLRATAGKIDDVTTVLRHVAFDRPFDAAPVVLATVSDADESSPCTAQISGV
TAEGFDVRLMYERTAATADAAATVGFVALSTGTGTVGGRELVVGRTALSAVGTSSAAATA
IGYGRDLGETALFCAPQTGESGVGATLRATHMSGSSAAVFMSAEASAGAAAPVPESIGWC
AVGASQAGLDRPGSITAALVYDSAARSIRRTDGAHLGTVTVYDTAGAECLKASATAALST
GSLPAGMYIASATGCGSAIRFLID

Enzyme Prediction     

No EC number prediction in MGYG000003985_00036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	241	464	1.3e-45	0.9553571428571429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	2.52e-36	242	464	19	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam01229	Glyco_hydro_39	3.84e-08	272	399	125	274	Glycosyl hydrolases family 39.
pfam09458	H_lectin	2.20e-04	686	729	2	49	H-type lectin domain. The H-type lectin domain is a unit of six beta chains, combined into a homo-hexamer. It is involved in self/non-self recognition of cells, through binding with carbohydrates. It is sometimes found in association with the F5_F8_type_C domain pfam00754.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB49856.1	3.38e-109	41	766	67	759
BAV05333.1	5.83e-87	41	547	557	1028
AXY72824.1	4.84e-85	41	522	407	855
AEV99551.1	3.35e-82	41	589	429	961
QOG04727.1	7.82e-79	55	523	581	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	4.84e-21	243	442	47	236	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.20e-20	243	442	47	236	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	2.98e-20	243	442	47	236	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	2.98e-20	243	442	47	236	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
6UAX_A	1.69e-10	242	442	116	317	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.017447	0.911119	0.070070	0.000746	0.000300	0.000301

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003985_00036.