CAZyme Information: MGYG000003970_02418

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000003970_02418
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666		76597.83	4.6143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003970	3341610	MAG	United Kingdom	Europe

• Gene Location: Start: 458; End: 2458 Strand: -

Full Sequence      

MAQWIWYPGDFEFFLGLKVASSRTERGTVIVPNWRVESFYHNVRFEKEFYLEEDTYIKIY
STGTQSVTMDLDWYSHYDPEKGVFVTKGKHTIWVHVFNRDQLPSIYIDCPGLETDESWVV
TCDHVNRRSVGYWNFTKREEPPTEFRLETTPIEPMAVEKTESGCLYDFGRETMAFVKGDA
VKGSGELTLFYGESREEALDTEECCIFERVKVEEGSGSFYVPRSQAFRYLYVPDVPGLTV
GHLSADYEYLPVVNRGAFQSEDSLLNEIYDISIRTMHLTAREFFLDGIKRDRWVWSGDAT
QSYLINYYSFFDNDICKRTMRLIRGKDPVLIHFNTIQDYTLYWFISLWDYYLYTGDKAFM
EEMYPAACTLMDDFCLPQTDTRGFLMAKPDDWVFIDWADIPDMTKGDISFIQLLFAYALD
ALAKIADVVGEQKGHARYAERYRTLMDAIFDTFWSEEAGCFTHGPADAPGAYVTRYTNIF
AILLGCLDSEKKQRVIDSVLCNDEIYGITTPYMKFYELLALCEAGMFDRTEKYIKSYWGG
MIDLGCTSFWEKYDPKNVGAQHAEMYGLKYGVSFCHAWGAGPVLLFGKYYLGVRPVSPGY
ERFVVEPHLIGGQEISGKVPVPEGEICVSLSREQVTVENHSKGVGELKIDGKSIEIPAGA
CVRVER

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	162	635	2e-97	0.9543650793650794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.50e-21	256	589	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.25e-07	333	510	335	518	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	5.83e-04	333	499	80	259	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam04685	DUF608	0.008	347	442	108	199	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH81526.1	3.52e-206	2	653	29	692
AGA77946.1	6.46e-205	2	653	33	696
AXP80063.1	1.12e-202	2	653	13	675
QIP13638.1	3.03e-200	2	664	24	698
QIK55686.1	1.83e-199	2	653	23	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.88e-185	4	652	20	697	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.22e-36	102	624	367	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	4.80e-34	257	589	208	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	4.02e-11	74	611	229	855	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003970_02418.