CAZyme Information: MGYG000003970_01701

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000003970_01701
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	MGYG000003970_241|CGC1	55592.89	5.4731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003970	3341610	MAG	United Kingdom	Europe

• Gene Location: Start: 3049; End: 4524 Strand: +

Full Sequence      

MSAFPKGFFWGGATAANQYEGGWDAGGRGPALTDVITAGTATAPRMETYQMPDGSIKALP
SMMPCPAGAKPVVAEGYYYPNQQAVDFYHRYKEDIALLAEMGYTMFRMSISWSRIYPKGI
EEKPNQAGLDFYHKVFAELKKYGIEPLVTMCHYDTPLYIEEELGGWENRNTIALFDKYAR
TILDEYKDEVKYWLTFNEINSLTLTLEFIPNCPKEMAAATYVKLHHQFVASAHAVRYAHS
VSPDYKVGCMIAGSCYYPLTCDPADMHKTQQKWQEATYYCGDVMVRGAYPAFAKRIWAEY
GVQLDITEQDKADLLAGKVDFYSFSYYATSCVTTHKDVAKDGAGNLSLGAKNPYIKYSDW
GWGMDPSGLRYYLNEIYGRYQIPLMVVENGLGAVDTLEPDGSVHDPYRIEYLRGHIQAME
KAINEDGVDLRAYTPWGCIDLISASTGEMKKRYGFVYVDLDNEGHGTRDRYRKDSFYWYK
KVIASNGQDLT

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	487	1.1e-144	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	490	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	490	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	489	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	491	5	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	9.17e-168	4	490	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR24563.1	1.18e-260	1	490	1	489
ANU67624.1	1.18e-260	1	490	1	489
ASU19945.1	1.18e-260	1	490	1	489
QRT30708.1	5.34e-252	3	490	2	488
QHB24556.1	2.17e-251	3	490	2	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	6.42e-165	1	490	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.83e-164	1	490	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.33e-160	2	490	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	7.09e-159	4	490	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	5.67e-158	5	490	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	3.66e-166	1	490	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	1.82e-162	3	490	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	7.58e-162	1	490	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P26206	1.94e-157	4	491	5	464	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46829	3.11e-157	5	490	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999858	0.000193	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003970_01701.