CAZyme Information: MGYG000003970_00898

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000003970_00898
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000003970_90|CGC1	55833.6	5.5215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003970	3341610	MAG	United Kingdom	Europe

• Gene Location: Start: 5856; End: 7307 Strand: +

Full Sequence      

MKNVLFVASECVPFIKTGGLADVCGALPKEFNKTEWDVRVVIPCYSCIPEKWRSQFEYVI
HFYMGAGPYIPEKYVGVLQYRYQGITYYFIDNQDYFNTSQAYGDTRGDIEKFIFFDKAVL
SMLPLIDFRPDLIHCHDWQTGLIPVYLKTEFAASDFFQGIKSVVTIHNLKFQGVWDIETI
QGLSGLPGSLFTPDKLEFQKGANMLKGGLVYADYITTVSDTYANEIQSDYYGEGLNGLMY
ARRLDMQGIVNGIDYTEYDPNTDKKIYVNYDAASFRNKKWKNKQAIQQELGLLPDRKKYM
IGLISRLTDQKGLDLIECVMDQIVDEFTQLVVIGTGENRYENMFRHYAWKYPERVSANIC
YSEELAHKLYAAADAFLMPSRFEPCGLTQMISFRYGTVPIIRETGGLKDTVHPYNEYENS
GDGFSFANYNAHEMLDVINYSKKIYFEKKRNWNQIVDRGMANDYSWRVSTGKYEGLYRYL
LGM

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	3	478	6.4e-174	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	3	478	1	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	3	482	2	465	glycogen synthase GlgA.
COG0297	GlgA	0.0	3	483	2	481	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	3	480	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	5.54e-112	4	481	6	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN96679.1	1.29e-293	1	482	1	482
CBK90689.1	5.84e-290	1	482	1	483
CBK94995.1	5.84e-290	1	482	1	483
ACR75702.1	8.29e-290	1	482	1	483
VCV22101.1	2.54e-286	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	5.56e-82	3	477	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.92e-81	3	477	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.49e-80	3	477	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	2.46e-78	3	481	2	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
1RZV_A	2.21e-75	3	481	2	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	2.06e-231	1	480	1	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	2.10e-219	1	480	1	478	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
A5N2Z2	9.42e-156	3	481	2	475	Glycogen synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=glgA PE=3 SV=1
B9DWP3	9.42e-156	3	481	2	475	Glycogen synthase OS=Clostridium kluyveri (strain NBRC 12016) OX=583346 GN=glgA PE=3 SV=1
B7GK04	2.56e-155	3	481	2	475	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003970_00898.