CAZyme Information: MGYG000003970_00064

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000003970_00064
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000003970_3|CGC1	40926.53	5.9524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003970	3341610	MAG	United Kingdom	Europe

• Gene Location: Start: 8637; End: 9731 Strand: +

Full Sequence      

MSGVLTVMKDRIEFPFHEKIRFFGRCADRKELNARFFNWSGSGFTFSFVGSEVRCRLLGC
LRGEDIPDEASRAYIAVFIDDFPRCTARFPIVSADGWYTLAEGLPCKHHTVRVIKDTEAG
YGRAAVAAVETDGCFADAPALRDRRIEFIGDSITCGYGNLCSNASPDFTTAEESFVNTYA
FYACEALDCEAEVVAASGNGFHRDYGCNSVNLIPELYEYTDKLLDGHLGMPAERWNFSRQ
KCDMIVMKLGQNDFQYCSGADLADDCKTEQRLQKRRAEFESSVRRFFTRILEARRGIPIL
LIYESDMGLKKELLSGISGLSERVKLLEIKPKRDYEGVGANGHYSVCTHARVGLLVAERI
RELL

Enzyme Prediction     

EC	3.1.1.72	3.1.1.-	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	145	353	1e-36	0.9617224880382775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17996	CE2_N	8.13e-16	34	139	12	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd01831	Endoglucanase_E_like	1.73e-11	145	361	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64864.1	9.29e-32	19	306	32	289
BBL09267.1	4.59e-29	18	302	31	285
BBL12059.1	4.59e-29	18	302	31	285
ADL50870.1	9.23e-29	18	364	21	362
BBL01336.1	1.21e-28	18	302	31	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.19e-20	39	360	29	323	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	5.57e-20	39	360	29	323	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	2.71e-18	20	264	2	227	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2WAA_A	7.43e-13	42	254	32	238	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
2W9X_A	1.61e-09	102	254	100	249	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	5.59e-19	39	360	510	804	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	4.34e-12	42	254	51	257	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	8.61e-09	102	254	100	249	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003970_00064.