CAZyme Information: MGYG000003967_00048

Basic Information

• Species: UMGS1338 sp900550805
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1338; UMGS1338 sp900550805
• CAZyme ID: MGYG000003967_00048
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		72884.91	5.5648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003967	2064493	MAG	United Kingdom	Europe

• Gene Location: Start: 51878; End: 53788 Strand: +

Full Sequence      

MQVFEGAKWIWLHNEKSRDEYGEFFAVFNSEKENAVCRISCDGDYTLFINGSAAGSNQYG
DFEHYKIYDEIDISRYLQKGKNAIAILVWHYGDDFQRYKTAQAGLIFEICRNEQVLLASD
ERVHCRQSRAYKSGLCKRITNQMGFSFLYNASKEDNWREKGFDSINPSVTVNKTCTFYPR
PTKKLQLCARKPVKILKNEKNYYLVDLGEETVGLPTMEFVSPAEQKITVCWGEDIQEGHV
RRIIGDRDFSYEYIAKTGNNCYTNYMLRLGCRYLELYSEQEIQLRYLGLIPQVYPVNVLP
FSLECGEDRRIYDVCVKTLQCSMMEHYVDTPWREQCLYAFDSRNQMLCGYYAFENGNAQY
ARAGLQLLSEDIRQDGLLPICAPCGVNLAIPSFSLHYVIAIGEYLAHTGDAAFVQEVFPR
LLSILKAFIHNRHNGLVCRFSESDQWNFYDWSSYLEGNLFGTEKKEPDLIVNCLFIMALD
SLNKICKRISVPFEYEALLSESRKNTAYAFYNADKKAYSLTAGGGEFTGLGNSLAIIAGI
AENPAELCEMLADGCFTEASLSMKCFKYDALLMTDFSRWKDYVLEDIRRDYRKMLDAGAT
TVWETIEGASAFGNAGSLCHGWSAMPVYYYHKILKA

Enzyme Prediction     

No EC number prediction in MGYG000003967_00048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	196	632	7.9e-57	0.8650793650793651
CBM67	7	163	9.6e-23	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.02e-16	302	634	5	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	4.08e-04	355	429	46	121	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	8.87e-129	6	633	10	707
QNK57365.1	1.18e-100	1	634	1	713
QGQ97405.1	2.43e-100	1	634	3	714
ARN56684.1	1.17e-99	7	634	23	712
AQQ71631.1	1.32e-81	3	634	6	693

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	5.17e-25	204	629	440	871	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.19e-09	190	628	181	630	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003967_00048.