CAZyme Information: MGYG000003959_01677

Basic Information

• Species: HGM12713 sp900754175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12713; HGM12713 sp900754175
• CAZyme ID: MGYG000003959_01677
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000003959_67|CGC1	56346.04	5.3014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003959	2369548	MAG	United Kingdom	Europe

• Gene Location: Start: 11194; End: 12687 Strand: +

Full Sequence      

MSFREDFLWGGAIAANQVEGGFREGGKGISVADVIIGKPKLDRRDYSGHLAITEADVRAA
LTAPDDNYPKRRGIDFYHRFRQDIALFAEMGFRVLRLSIAWSRIFPRGDEEEPNEEGLAF
YDEVFAELKKYGIQPMVTLSHYEMPVTLALEYGGFADRRVIGFFQRFCRVCFKRYREQVK
LWLSFNEIDSVERHPFITAGILVDRYPEEERLSVIYNALHHQFVAAACATRDCHCLIPDA
KMGCMLTKLTTYPLTCAPEDVAAAQEKNLFNQFPADVQMTGVYPPLILNRLNRMGVRLKM
TAEDLALIKENPADFLSFSYYMSLCAAGEESGKDTTAGNTVLGLKNPYLQESEWGWQIDP
LGLRTSLVELYDRYRKPLFVVENGIGAEDHPEAKGRIRDDYRIAYFASHIQAMGQAVEMG
VDLMGYTSWAPIDLISAGTSQMSKRYGFIYVDQDDFGGGTLERRRKDSFEFYRQVIASNG
EAAEAEAERREKIHAGV

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	480	7.6e-133	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	480	2	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	480	3	470	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	480	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	480	4	474	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.63e-173	1	480	4	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB87491.1	8.96e-224	3	481	8	486
AIF67468.1	1.23e-222	1	481	1	481
QLB15636.1	1.32e-222	6	480	7	482
QAS18470.1	2.02e-222	3	481	7	485
QCY01555.1	2.02e-222	3	481	7	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.18e-172	3	482	8	468	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.95e-158	1	481	6	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	1.84e-157	3	482	20	484	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	2.18e-154	5	481	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.19e-154	5	481	9	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.14e-174	3	482	8	468	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.08e-169	3	484	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	8.32e-168	2	480	3	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	9.89e-167	3	480	5	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46130	6.01e-165	1	484	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003959_01677.