CAZyme Information: MGYG000003958_00546

Basic Information

• Species: CAG-312 sp900545715
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545715
• CAZyme ID: MGYG000003958_00546
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000003958_2|CGC2	58833.53	8.1143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003958	2427590	MAG	United Kingdom	Europe

• Gene Location: Start: 76820; End: 78403 Strand: -

Full Sequence      

MNMRNILMIGAAALAATPSFAEELEIAVNPQQKFQTIDHFAAADAWSGNFVGKHFPEEQK
NQIAKWLFSQKLGPDGNPEGIGLSMWRFNIGGGSFEQDGADIEPYQRRAESFLTKDGSAY
DWTKCAGQMYFMKKAKEYGCDKFLIFSNTPPVQWTKNGKGWGAKENYGANLKPDCYGKFA
DYMATVAKHFTELGYNVQYISPINEPQVPWDSPRQEGSRWRNSEMAKLARELDSSIEKSG
LKGTKILLGESASLTAPVDGATSWYWKFDKCPKEEQPFGQLKQFFDKASPNYIGDLKHLE
RYWAAHTYHSGKKIADMPKIRKALAAEVGKYGLEFLQTEWCLLPSYNQKNCDGFSADRFS
DNNGDIQAALCMGRLITADLSIAQSRGWGYWKGMEVKGDFALTGVYPKDGKLENGGVVRD
NKILWALGNWSFFVRPGFKRVEISGADDLAKVSSSAFVSPDGKRVVAVFVNSSYESYPAK
FKGELADKEFTVYKTDSNSSLAKIAESLSGGFTFTPRSITTLVWDLK

Enzyme Prediction     

No EC number prediction in MGYG000003958_00546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	25	523	3.5e-151	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.98e-104	26	391	4	353	O-Glycosyl hydrolase family 30.
COG5520	XynC	4.97e-16	11	526	17	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	1.33e-04	439	522	3	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36080.1	9.77e-120	17	527	36	541
QNT66374.1	1.76e-119	1	527	1	531
BCS84534.1	3.24e-113	12	526	11	530
ADQ16581.1	6.38e-112	26	525	32	519
QIK54438.1	2.80e-111	16	527	32	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.81e-71	28	523	10	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	1.16e-11	11	523	10	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	1.31e-08	414	523	332	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.39e-08	414	523	339	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	7.56e-08	414	523	356	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.998809	0.000182	0.000224	0.000204	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003958_00546.