CAZyme Information: MGYG000003958_00509

Basic Information

• Species: CAG-312 sp900545715
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900545715
• CAZyme ID: MGYG000003958_00509
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000003958_2|CGC1	43242.53	9.4655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003958	2427590	MAG	United Kingdom	Europe

• Gene Location: Start: 32748; End: 33923 Strand: -

Full Sequence      

MNPDVLKMRSFRFAAPAEGRCDLLVIAGEHSGDEQSARMVSDALKINPDLKICAFGGEKL
SECGAQLLFDMTSFSVVGLVEVLKNYGFFKKLSEAVVDWIGKYRPKAVCFVDYPGFNLHI
ASILKRRGISQKGGGDVRLLYYISPQIWAWKASRRFKMAELLDSLAVIFPFETKCYADTN
LDTHFVGHPFLSDSYQPPVVYDTDGEILLLSGSREIAVSRIFPVMCGALERIDGAKAVAV
YPTERIKNILQKEISRRPALKDRVRIVPNGGSSALAAKAVMMSSGTMSLACSLQGIPGAI
VYKANPFTYFVGRALVKIKYLSIANILLDKPAWREFIQFDASAQPLAEYMKECLKPSARK
NFAEYAKILRGLLHSPPSLSAAQWLCLKGGF

Enzyme Prediction     

No EC number prediction in MGYG000003958_00509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	24	366	1.5e-85	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.94e-80	23	371	4	361	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.66e-76	24	383	5	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.78e-67	23	354	1	339	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.98e-51	23	348	8	339	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.33e-48	68	385	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY34968.1	1.44e-135	17	391	6	382
QXD30622.1	1.32e-133	1	385	1	388
AKC82833.1	4.22e-130	11	390	9	384
ATC65221.1	5.41e-130	13	385	10	378
AHF91230.1	4.72e-128	11	385	10	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.36e-30	23	347	9	338	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.36e-30	23	347	9	338	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KC41	6.26e-58	23	354	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	6.26e-58	23	354	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	6.26e-58	23	354	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	8.79e-58	23	354	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	8.79e-58	23	354	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003958_00509.