CAZyme Information: MGYG000003957_00968

Basic Information

• Species: Parabacteroides sp014287585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp014287585
• CAZyme ID: MGYG000003957_00968
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955	MGYG000003957_13|CGC1	105976.88	5.3919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003957	4724401	MAG	United Kingdom	Europe

• Gene Location: Start: 27314; End: 30181 Strand: +

Full Sequence      

MKKNKLTFLASCLVLSGTLCTQAQNKTPQEIRIPDTYKLTNKSIYRNGWIDFNKNGKKDV
YEDPAAPIDARIEDLLSQMTVEEKTCQMVTLYGYKRVLKDDLPTPEWKNQLWKDGMGAID
EHLNGFQQWGLPPSDNPYVWPASRHAWALNEVQRFFIEETRLGIPTDFTNEGIRGVESYI
ATNFPTQLGLGHTWNRDLVHKVGYITGREGRLLGYTNVYAPILDVGRDQRWGRYEEVYGE
SPYLVAELGVEMAKGMQTDYQVAATSKHYIAYSNNKGGREGMARVDPQMSPREVEMIHVY
PWKRVIKEAGILGVMSSYNDYDGFPIQSSYYWLTTRLRGEFGFRGYVVSDSDAVEYLFSK
HGTAADMKESVLQSVLAGLNIRCTFRSPDSYVLPLRELIAEGALPMSTIDDRVRDILRVK
FLVGLFDHPYQIDLKEADKEVNSVENQQVALQASKESLVLLKNQDAILPLDVNNVSKIAV
CGPNANEEAYALTHYGPLAVEVTTVLEGIQNKVKPGTEVLFTKGCDLVDANWPESELIRY
PLTGEDQSEIDKAVENAKKSDVAVVVLGGSNRTCGENKSRSSLELPGRQLDLLQAVVATG
KPVVLVLINGRPLSINWADKYVPAILEAWYPGSQGGTAIADALFGDYNPGGKLTVTFPKT
VGQIPFNFPTKPNAQVDGGRNKGLDGNMSRVNGPLYPFGYGLSYTTFEYSDISIQPAVVT
QVQPVTVRCKVTNTGKRAGDEVVQLYVRDVLSTVTTYEKNLVGFDRIHLNPGETKELAFT
IEPRDLQLLNSDNHWVVEPGDFKVMVGASSEDIRLNDRFTVVEYGKEPTNASAASRQQKS
VIASSSQESATLVLDGNLSTAWKANKGEYITFALENNASPNSIAIAWKEKSKDAKFEIQL
SGGGGQFLTVYEGTVEATNELKNYRFKGTTASDIRIVITSGNASISEVKIKELKS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	158	383	1.9e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.23e-172	69	820	35	763	beta-glucosidase BglX.
PLN03080	PLN03080	9.45e-91	67	807	48	769	Probable beta-xylosidase; Provisional
COG1472	BglX	1.13e-72	145	518	41	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.29e-70	458	704	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.56e-56	80	419	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50560.1	0.0	1	955	1	955
QIU94792.1	0.0	1	954	1	945
QIK54931.1	0.0	8	954	3	940
QIK60364.1	0.0	8	954	3	940
QUU08154.1	0.0	1	954	1	945

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.52e-129	149	821	69	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	8.18e-129	149	821	69	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.16e-124	57	821	3	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.72e-124	57	821	3	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5TF0_A	2.31e-123	149	814	68	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	8.31e-139	161	811	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	3.07e-131	69	814	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.76e-129	69	814	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.40e-118	61	814	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.50e-94	63	813	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001050	0.687227	0.310630	0.000423	0.000355	0.000289

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003957_00968.