CAZyme Information: MGYG000003937_00865

Basic Information

• Species: Gemmiger qucibialis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger qucibialis
• CAZyme ID: MGYG000003937_00865
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	MGYG000003937_35|CGC1	81704.83	4.7509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003937	2463546	MAG	United Kingdom	Europe

• Gene Location: Start: 8444; End: 10699 Strand: +

Full Sequence      

MPKASDNIKIYRNPNGPVVSTVNRRVLEQDGLTFKDIDGTGTLSPVNDWRNSPAERAAAY
VKTLSVKEKIAQLFISDWRMAKYPITGPMADLYKDIEKKTDETGILDEGEFRGKTIFGEQ
YLPGTSPLLKDWFNRHVILRANATPADLADWMNQADAVCEECEHFIPVAAASNSRNENGE
LVFGMNDAGGVLATWPGTLGIAAAVKGSKIDLVDKFADTIRREWNACGLRKGYMYMADAV
TDPRWQRTYGTFGEDPALISEIMAHIIPRIQGSDHGVTEDGVAVTTKHFPGGGARENGFD
PHYAAGQWNVYATPGSLETYHLPPFAAAVKAGTSSIMPYYSKPAAAKSAVQHDLAGNTVE
MKPYGFAYNKYFIDTMLRGQMGFDGYINSDTGIAHNMAWGVEMLDVPERIGFAVANAGVD
IISGLFDNEAGMEAYNRGKNGYYETHPLPEGFAKEELTLTDEALNRAVARTLTELFALGM
FENPYRDPDEAARIVATPSDWEAAADAHRRSVVLLKNDGALPLTADKRANKKIYAEAFLK
NAKHAADSTAALRKELADTCTLVDDPAQADFALLFVSPSSGEYFNATPGYLELDICEDKT
VCNVDANGKPMADTHTETTLHGGKRLAEIAASVHANGGKVITNVNITLAWQLGNVEPLCD
VLLAGFDTYRSATLDVIFGCFAPTGKLPLTLPRGDAVLAVNADGVCISPNDVPGYDKDRY
MPDSLKDENGKAYAYRDAAGNYYEYGFGLEG

Enzyme Prediction     

No EC number prediction in MGYG000003937_00865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	170	422	2.2e-44	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.04e-20	194	749	119	646	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.16e-19	144	473	44	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	4.03e-11	242	523	163	415	Probable beta-xylosidase; Provisional
PRK05337	PRK05337	1.90e-08	252	422	137	277	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30064.1	0.0	3	749	4	747
ATL90129.1	0.0	3	749	4	745
QIA41664.1	0.0	3	749	4	745
ATO99950.1	0.0	3	749	4	745
AWY99446.1	0.0	3	749	5	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	4.17e-24	180	701	129	597	Crystalstructure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5XXL_A	1.39e-19	181	693	86	587	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.53e-19	181	693	86	587	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.51e-17	181	693	85	586	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	5.89e-17	195	749	88	614	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46684	5.25e-58	17	692	21	624	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
B8NGU6	8.94e-57	125	692	92	592	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
Q2UFP8	2.05e-54	125	692	96	596	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
Q5BCC6	6.45e-53	55	703	47	597	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
T2KMH9	2.76e-24	212	693	155	601	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003937_00865.