CAZyme Information: MGYG000003925_02747

Basic Information

• Species: CAG-882 sp900545175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545175
• CAZyme ID: MGYG000003925_02747
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000003925_61|CGC1	48110.18	4.3444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003925	3268447	MAG	China	Asia

• Gene Location: Start: 1491; End: 2804 Strand: -

Full Sequence      

MEPILINSVDISAAGKNCKVLLGDINGDGRMELVCVQANGGTDSRYVPFYVTCLTAFALT
GELLWQVGTPWEEPGGFGADFPAQIYDIDGDGRLEVIAVMDANRVVSGEKNGAADNDKEA
VNKNIIVVDGATGQLKRKKPIPAWEAHDCILIANLSGNPTAREIIVKDRYENMWALDENF
DVMWTHSGNLGHFPLVYDINGDGRDEVMAGYDMLSADGRLMWSCKDLDDHADCLWVGDVN
GDGKPEMCVGGSVTCLYDMDGNELWRYDGSIESQHIALGKYILGAPGLQVAGLDRISRGD
GYKGMWHGKDGMFLLDCNGKELWKEDRKTDGWLTIVNTYRNWNGEGRDYILAYRRGGNVM
PALYDGDMNVVVSFPTDGYVVSADLFGRSIEDMVIYADGKAWIYSGTAYDLTQAPSGRQL
AQTQKLFRSTLYPGCVY

Enzyme Prediction     

No EC number prediction in MGYG000003925_02747.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	7.51e-05	23	238	117	367	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96195.1	5.54e-206	1	437	1	415
ANY76765.1	3.50e-181	1	434	1	412
ASA19480.1	1.15e-180	2	434	9	418
AIQ45990.1	4.98e-180	9	434	7	410
AIQ73155.1	6.62e-180	9	434	15	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	4.88e-09	22	249	119	380	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	2.03e-08	22	244	123	380	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
4CAG_A	1.32e-06	22	240	126	379	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	2.74e-08	22	249	156	417	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	1.11e-07	22	244	123	380	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999812	0.000208	0.000003	0.000002	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003925_02747.