CAZyme Information: MGYG000003924_00382

Basic Information

• Species: Mailhella sp900555975
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella; Mailhella sp900555975
• CAZyme ID: MGYG000003924_00382
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000003924_17|CGC1	38572.45	8.268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003924	2228813	MAG	China	Asia

• Gene Location: Start: 14636; End: 15664 Strand: -

Full Sequence      

MARYSSRISNKHMVVVRFSSLGDVVLTTGVLLDWHKKHGTMFTVITKEAFEPVFAGHPAV
LNVIGFDENDLHGQTQAMNFRGLMEKYRDSPLLDLHRNLRSAMLARIWRDAIICYSKMSL
ARRIFLLSRGRFFGEQLRRFNVPQRYAIGLYDKENVPSAAELRPRIFLTDEENTAAAARV
APLRRDGRPLVALHPFATHAAKTWPTDRWLRLAALLEQENIDYFWVGQGEGFPAQESSRS
FVNDTGLRELFALIHEADVLITGDSGPMHIATAVDTPVLAMFGPTCREWGFFPSGERDRV
LQLPMACRPCSLHGADACSRNFACITGIEPDLVLAELKSMLR

Enzyme Prediction     

No EC number prediction in MGYG000003924_00382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	93	315	1.2e-42	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.64e-41	11	342	2	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	7.42e-39	15	338	4	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.33e-19	144	310	66	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	8.58e-17	144	342	132	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	7.87e-12	144	341	133	343	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGB16504.1	9.91e-99	6	341	3	335
AAS96432.1	7.37e-97	8	341	3	333
ADP86511.1	7.85e-97	8	341	5	335
AMK12356.1	1.29e-96	14	341	11	335
ABM28232.1	1.48e-96	8	341	3	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	1.77e-08	144	341	133	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	5.63e-08	11	285	9	290	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	9.36e-06	13	285	3	282	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	9.36e-06	13	285	3	282	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	9.58e-06	13	285	3	282	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	3.82e-10	144	341	133	343	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P45042	3.93e-09	144	303	131	307	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	3.96e-09	144	341	133	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35