CAZyme Information: MGYG000003922_01970

Basic Information

• Species: Bacteroides sp014385165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp014385165
• CAZyme ID: MGYG000003922_01970
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1019	MGYG000003922_27|CGC1	116932.17	5.3627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003922	4876803	MAG	China	Asia

• Gene Location: Start: 21257; End: 24316 Strand: +

Full Sequence      

MRKRTGFIIAMLLFAGYGVHAEETDDLYVVPRVVEKKWTNFNLSDVRLLDGSYFKKMQDQ
HLNYLLSLDPERLLNNVLRGGDIPTSAANYGGWQHDNGNGFSNYMAGCAMMYASTGDVRL
LERIKWMIDQIAVCQEKENLDGFFYFGRSKGAASYNALMAATGNGVYPVNNGEDFYTNSA
MAGMAFYQLHRIFYGIRDVYYYTGYEKAKTVFVKCMEWACKWTDLIPEDAQLQMALEAEH
GGMTELFVDAYALTGNKRFIDNAERWVHSLNFRDQMAKGNDVLTSRHANVYDPKYMGLIR
DYEFTGNEQNRDAALNTWDIVVNHHVLSMGGHGRWERYGEPGKFLDQLANTSTETCCTNN
MLRFTKAMFSVFGDGKYLDFYEKALYNHILASKDPDNQSVGGGFCYYQSLMPGQCRKYMD
DNSFYCCWETGLENHSKYGEAIYFHNDDDILVNLYIPSTLEYEDRGFSMRMEGDYPLENE
IKLTILKNQDFNGTIRFRCPQWMDASRVNITVNGQTQKVNIESGKFINIRQAWKAGDVIV
LSMPVELRYEPSEEPNVVSLFYGPLVIVPNLGAVASGDYVSNVWDQQGDTQIDKFPDFPN
FTQSKEELSTWMKRKEGTLEFTAQGADQTYNFVPFYQANHMRTSVYQRFTGEKDKKWENN
YVPDRIIFNVNETEHAYGGRTSLEKNYNRYYRHVDKGRSLSYTLKLSETSGTQHWIAIKH
QGWETEEVGDYEVYIDDALIGSIGACEKLKQFTYPTNFFKIPLDLTKGKSEVRLKILQKD
RAMNYYGIEIVTDKYLEEFYPETKYAYESSLPATRLEAEASQPHESNRTFDGLSSSGAYV
SRLSTYLQFNNVFVKKGGTYHLSVCYRGSASLRYNVTVNDVVTEVKYPSTNGEWQTYTSE
IELREGFNTIHLAPTTVRTPYDVDYIELQPAGSSALGTILSDWQRFSVYPNPCSDFAYFK
TTADWVGVISIRDMQGKLLYSFNYPNQNKLEVNGLSNGVYMVSFDDGKDHNTTKLVVYK

Enzyme Prediction     

No EC number prediction in MGYG000003922_01970.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	46	567	8.9e-142	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.93e-125	45	566	1	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.31e-81	43	566	14	499	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam18962	Por_Secre_tail	1.47e-10	948	1017	1	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	3.51e-10	948	1017	1	71	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
cd04081	CBM35_galactosidase-like	1.15e-09	814	928	1	125	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND18711.1	4.56e-141	1	793	1	793
ALA72776.1	4.56e-141	1	793	1	793
AII66952.1	4.56e-141	1	793	1	793
QJR53575.1	4.56e-141	1	793	1	793
QUT86298.1	4.56e-141	1	793	1	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.17e-86	3	656	2	657	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.60e-81	3	656	2	657	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.95e-19	306	584	284	574	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.95e-19	186	566	142	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	4.10e-18	306	584	284	574	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000431	0.998358	0.000549	0.000220	0.000210	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003922_01970.