CAZyme Information: MGYG000003912_00757

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_00757
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000003912_4|CGC1	91400.39	6.5453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 78901; End: 81318 Strand: +

Full Sequence      

MKKTLLALFCLMATASLWAQERLYPNTFPLGKVQLLDGPFKHACDLNIKTLLAYDTDRLL
APFLKEAGLPLKGELFPNWEGLDGHVGGHYLTALAIHYAATGDQRLKERMDYMLSELKRC
QEANGDGYVGGVPNGKMCWDEIKKGNVGIIWKYWVPWYNMHKIYAGLRDAWSYTGNEQAR
QMFLELCDWGLTVIAPLNNQQMEQMLENEFGGMDEVYADAYQMTGDLKYLDAAKRFSHHW
LLDSMVKGVDNLDNKHANTQVPKVVGYQRIAELCEQAGQLEDAATYKKAAEFFWQTVVYN
RSLALGGNSRREHFAAATDCRSYVEDREGPESCNTNNMMKLTEGLFRMTPNAQYADFYER
AMLNHILSTQHPVHGGYVYFTPARPAHYRVYSAPNSAMWCCVGTGMENHGKYGEFIYTHQ
GDSLWVNLFVASKLNWEEKGMTITQETQFPYEEATRLTINVKKSRKAKLLIRKPSWCKDE
EMKVICKGEDYAAKGAQANGYILIDRKWKDGDVVEITLPMHVRLEQLPNVPEYVAIMRGP
VLLSCRMGTEGLDGLVADDSRWGHIAHGPLVSLFDTPALIGQRDQLQAALEKMTPVPGKP
FHFTVANLFSLKGEKLPSIELEPFFSLHDSRYMMYWLSMEQPAYDKMMQVRKEAELRKLD
LDRRTVDMVTPGEQQPEVDHKAKYEGSTKGNFQNMPYRDAKDGGFFQYELATQGRTDLTL
VVDYWGNESGARAFSILVDGQPLAEESLSGKWNKEALVSQEYPLSADLLKDKEFITVRFQ
SYPGKIAGGVYAVRLVTPKGSDVKK

Enzyme Prediction     

No EC number prediction in MGYG000003912_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	543	1.9e-199	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.03e-168	33	544	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.52e-109	30	543	9	500	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.19e-40	548	636	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37333.1	0.0	1	796	1	795
QCD36520.1	0.0	11	802	14	789
QUT88913.1	0.0	2	805	3	805
SCV06553.1	0.0	2	796	4	796
QRQ58640.1	0.0	2	796	4	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	8.14e-222	1	796	1	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.36e-214	19	796	19	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	5.21e-19	88	542	145	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.93e-17	287	542	289	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.08e-16	103	542	88	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999127	0.000175	0.000156	0.000146	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_00757.