CAZyme Information: MGYG000003912_00453

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_00453
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	MGYG000003912_2|CGC5	102930.21	6.4001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 144021; End: 146744 Strand: +

Full Sequence      

MIRKRSIDYFAYPREKSYLCATIAVIGYSDDNPYIINIDPTNMKHIIIGLLLAACAIPAG
AQVEISEQATASTDFPLYDGGKSCEIYVDPEDFEVVKKTATLFAEDLGRVTGKNGHVTIG
DKPVKGKNIVIMGTLGHNRFIDELVKQKQLDVSAIKHGWEQYTLKTIERPAKGIDRALVV
AGCDRRGTAYGAFALSEAMGVSPLYWWADVPVKRKKNVYVKALDYTSKAPCVKYRGIFVN
DEGWGITPWASKTFDKELGDIGPKTYGKVCELILRMKGNMLAPAMHPSSGAFHKYPANKL
VADSFAIVMTSSHCEPLQFNNVTEWNQETMGEWNYMTNKKGINKELDKRVSNTAPYENFY
TLAMRGIHDAGLVGVPKGKEVSLIEEVLDDQRAILSKYINHPIDSIPQQFVPYKEVMEIY
ERGLRVPDDVTLVWVDDNYGYMKRLSNPQEQQRKGRSGVYYHTSYLGAPHDYLWICTTPP
VLMYEELKKAYDTGADRYWLLNVGDIKPAELAIKTFFDMAWDIDRYDIHTINNHQATFLS
QLFGEDLKPRFQHVLDEYYRLAWSRKPEFMGWEREWDAPEYSELASTDYSFQHYNGALRR
LDDYKRLSDEANTLLQAMPAESRPAFFELLAYQAMASYQMNRKFLLAQLCREKQAEEKTE
EANWAATQSKMAYDSIASLNHRYNTQLDGKWNHMMTLAPGWVAKYQNMPELPYTQGKGET
PVDLTLRPEQDKLERCALVNLADFQVKSSSDHTLRLVKGMGYDWQVLQLGEALEALTDPT
SPSAPSVEYQLPKIDADSVTIHVYSLPFFPIYKGRGTSYGVSVDGAPVQVANNLPKEFSK
EWKDHVLQNGVEATFTFPVDRLKEGHTLTFTCGDPGVMIQRVILDWGGLKKTYVGPDIRI
TRTFPGT

Enzyme Prediction     

No EC number prediction in MGYG000003912_00453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	73	881	3.3e-227	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	9.93e-164	228	569	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.84e-24	752	897	15	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
TIGR01564	S_layer_MJ	0.001	59	197	421	569	S-layer protein, MJ0822 family. This model represents one of several families of proteins associated with the formation of prokaryotic S-layers. Members of this family are found in archaeal species, including Pyrococcus horikoshii (split into two tandem reading frames), Methanococcus jannaschii, and related species. Some local similarity can be found to other S-layer protein families. [Cell envelope, Surface structures]
pfam05124	S_layer_C	0.002	126	197	149	219	S-layer like family, C-terminal region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86808.1	0.0	75	902	33	967
EDV07546.1	0.0	75	902	32	966
AYD49386.1	1.89e-264	43	902	3	966
APZ45930.1	9.61e-258	44	902	5	960
AUC19792.1	9.61e-258	44	902	5	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	2.00e-154	74	884	19	773	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.05e-135	32	894	3	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	1.65e-119	75	892	16	826	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	3.30e-119	59	892	1	827	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	3.34e-115	77	896	16	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.389460	0.322491	0.272531	0.011721	0.002750	0.001040

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_00453.