CAZyme Information: MGYG000003908_01142

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_01142
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000003908_4|CGC4	35513.14	8.3432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 128241; End: 129176 Strand: -

Full Sequence      

MKKIYTILYLCFVVFCINIFIIVFKSKAANIPLPVAYAQDENNPEPLVSDVFMPAEFDLA
GETVPLQRLDVQESFKKELIVNTYLHSHTIQILKNAPRIFAVIEPILKANGIPDDFKYLA
VIESNLNPLAVSPAGAVGVWQFMKGTAQELGLEVNAEVDERYNIEKSTEAAAKYLQKAYE
KFGSWTMAAASYNAGSSMISKQMAIQKETDYYDLLLGEETGRYVFRILALKQIINHPELY
NFNVRTIYPSEKVKKVKVSGEVKSWADFAHEQGISYKILKRFNPWLRKTELRNPHHKTYE
ISIPVKTELYK

Enzyme Prediction     

No EC number prediction in MGYG000003908_01142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	101	240	9.8e-26	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.10e-64	107	232	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	7.08e-29	102	214	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	3.71e-27	71	284	80	293	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	1.55e-21	119	229	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.49e-17	115	234	11	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY32428.1	1.63e-149	1	311	1	311
SNV32652.1	1.63e-149	1	311	1	311
AZS32129.1	1.24e-124	49	311	46	308
QRO51442.1	2.88e-123	49	311	46	308
QGY43333.1	9.97e-102	21	305	21	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YT5_G	3.29e-07	94	228	28	165	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
7EYB_I	3.29e-07	94	228	6	143	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.14e-23	71	291	77	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.14e-23	71	291	77	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	5.71e-07	123	230	85	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P03726	1.80e-06	94	228	6	143	Peptidoglycan transglycosylase gp16 OS=Escherichia phage T7 OX=10760 GN=16 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980083	0.019184	0.000495	0.000068	0.000042	0.000151

TMHMM  Annotations     

start	end
7	24