CAZyme Information: MGYG000003904_00709

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000003904_00709
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000003904_117|CGC1	36833.35	9.4656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003904	2545601	MAG	China	Asia

• Gene Location: Start: 3041; End: 4015 Strand: +

Full Sequence      

MQEYRLHRTFRNCILHEIPFALHRQQPGFHRPESLLERNVFPLTEAAGVLSEEIRRAPVE
NKTAWSFGGIRADGCYHQHGPQVQFGNYDGEFFSNISYWSNIWKDTRWELSSPQWELVRH
LAFNGFQWVLWNGRMDLLAIGRQLGRNAAKDKGRRTLSAFEALKSADPGAGAEYDAVLER
NRGGRNTLVGNRHFWNSDYMVHRRPGWYAAVRMNSVRVRPIEDDTNGDNALGRYFSDGVC
LVMRSGAEYENITACRDWTRLPGSTLSATPVYTREESAKRGLRVGGKVPRWTHSVAFRPI
GETGFVGGVTDGTHGVAVYTMNLN

Enzyme Prediction     

No EC number prediction in MGYG000003904_00709.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	192	322	6.1e-25	0.4457831325301205

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.64e-41	68	322	212	480	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	3.99e-29	191	322	1	113	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	4.23e-09	69	178	209	321	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45527.1	7.23e-174	34	324	347	637
QBG49151.1	2.07e-46	69	265	215	402
AQT67414.1	7.23e-46	43	318	202	453
ACB77597.1	2.73e-44	45	318	211	454
QIU96737.1	7.94e-43	34	286	214	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.50e-23	69	322	193	430	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.53e-23	69	322	215	452	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2WCO_A	7.67e-07	69	314	234	507	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	9.84e-06	69	314	234	507	TheX-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	8.38e-23	69	322	215	452	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999920	0.000093	0.000019	0.000000	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003904_00709.