CAZyme Information: MGYG000003899_01896

Basic Information

• Species: Faecalibacterium sp900539945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900539945
• CAZyme ID: MGYG000003899_01896
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000003899_28|CGC1	54383.07	5.2219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003899	2460696	MAG	China	Asia

• Gene Location: Start: 16381; End: 17820 Strand: -

Full Sequence      

MAFCKNFLWGGATAANQVEGGWQEGGKGASAADMLSSGSHTTPRQITAETDPALYYPNRT
ASDFYHHHAEDIALMGEMGFKAYRMSIAWSRIFPTGEEERPNEEGLRFYDNVFDELHAQG
IEPIVTLSHYEMPLHLVNKYNGWASREVIALFERYARAVIRHYRGKVKYWLTFNEINCGT
LPLGNYMSLGIRNPGTRDFLRQVDNVPLRYQALHHQLVASAYAVLAGHEEDPDAKIGNMI
AMMPVYPLTCNPKDQLKAQQNWRQFNWYCADVQCRGEYPYYAPAFWRQNGIELEITEEDR
RTLKAGTVDFYSLSYYQTNCVTVDPDAAQASGNLLGGAKNPYLQTSDWGWQIDPDGLRFT
LNQIASRYDLPIIVVENGLGAYDKLEEDGTVKDPYRIDYLREHIKAMKQAVEEDGVPLFG
YTMWGCIDLVSASTGEMAKRYGFIYVDADDQGGGTFKRYKKDSFDWYKKVIASNGENLA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	475	1.4e-149	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	478	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	479	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	5	478	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	476	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	478	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL51289.1	3.65e-263	1	479	1	479
BBK23030.1	2.13e-257	1	478	1	477
BBK23062.1	7.09e-256	1	478	1	477
BBK22869.1	4.09e-255	1	478	1	477
BBK62637.1	9.56e-254	1	478	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	9.28e-184	5	478	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.37e-178	5	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.91e-178	5	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	2.68e-173	3	478	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	7.87e-173	5	478	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	5.08e-183	5	478	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	8.96e-179	3	478	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.80e-173	5	478	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	5.92e-173	1	478	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	6.14e-163	3	478	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993675	0.006239	0.000056	0.000013	0.000007	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003899_01896.