CAZyme Information: MGYG000003893_01259

Basic Information

• Species: Prevotella multisaccharivorax
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella multisaccharivorax
• CAZyme ID: MGYG000003893_01259
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000003893_33|CGC1	50686.27	9.6198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003893	2702422	MAG	United States	North America

• Gene Location: Start: 18588; End: 19937 Strand: -

Full Sequence      

MRFTLLVLAAIFCSQGFAQTQKWRDKYKVKKQDTLYGIAKQYGITVDALIEANPEMKVAG
YELKKGSYVLIPFAAGQQSQNGVVSTHAMAVSPSKPFAGKTVHVGVMLPLHNDDGDGRRM
VEYYRGLLMACDSLRARGMNIDIHAWNVNINADITNYMPMAEAAKCDIIFGPLYSKQVHA
LAEFCRARDIKMVIPFSVTGDDVSLYKQIFQVYQTNDRQTNSAIESFLKLFPAVHPVFID
CNDKTSTKGSFTFGLRARLESRNMEYSVTNLGSPDDLFAKQFSTSKVNVVILNTGRSPEL
TQVLHRLSVLKNRIPGLRIKLFGYTEWMMYLGIDEAKFHELDTYIPSTFFFNPSDPRTQS
LIQSYRRWFGTDMQAALPRFALTGYDHAQYFLRGFAQYGKAFKGVKGQSGWRAVQAPLQF
RQVGTAGMQNEFFQLVHFLPNGNVEAISF

Enzyme Prediction     

No EC number prediction in MGYG000003893_01259.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.24e-09	27	54	3	30	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.23e-08	26	64	1	43	Lysin motif.
pfam01476	LysM	3.41e-08	27	72	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	2.40e-05	4	66	46	105	LysM repeat [Cell wall/membrane/envelope biogenesis].
cd06335	PBP1_ABC_ligand_binding-like	5.18e-05	290	400	196	300	type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine binding protein (LIVBP); however their ligand specificity has not been determined experimentally.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46898.1	2.25e-178	2	449	7	451
ALO48876.1	1.48e-163	2	449	6	448
EFC70285.1	3.41e-161	3	449	9	454
QYR10688.1	2.06e-146	18	449	22	450
QUB71191.1	4.20e-138	1	449	5	460

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000542	0.979181	0.019606	0.000233	0.000212	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003893_01259.