CAZyme Information: MGYG000003883_02120

Basic Information

• Species: Kosakonia cowanii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kosakonia; Kosakonia cowanii
• CAZyme ID: MGYG000003883_02120
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000003883_98|CGC1	56139.58	6.8232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003883	4218591	MAG	United States	North America

• Gene Location: Start: 7830; End: 9257 Strand: -

Full Sequence      

MSTKTVTIPPDFILGAAASAWQTEGWKDKREGQDSWPDLWYKNDRHVWHQGYGPAVATNF
YQRFREDVQLMKQAGLTHYRTSINWSRFLTDYENGVVDERYAAYYDELFDEMARHGIEPM
ICLEHYELPGYLLETYGGWASKKVVELYLLYVGKVLARYHQKVTRWFTFNEPIVVQTRVY
LDALRWPYEQNTSTWMQWNHHKNLATAKVVKLFREKGYKGTVGCILNPEVTYPRSRAPHD
LLAAERYDLFYNRVFLDPMVKGHYPAELLALLDKHEVKWQYSDEELAIIRDNTVDELGIN
LYYPHRVKAPSRAWHPETPFHPAYYYEPFELPGRKMNTSRGWEILPEIVFDMAMRLKNEY
GNIPWFVAESGMGIENEGQFRNAQGTIEDDYRIDFIAAHLYQTLRAKEAGSNCQGYMLWA
FTDNVSPMNAFKNRYGLVEIDLQHNRDRRPKKSLGWFRKLRDERQLTLTLDDEVR

Enzyme Prediction     

No EC number prediction in MGYG000003883_02120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	462	2.4e-117	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.88e-149	9	471	5	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.64e-110	7	460	4	447	Glycosyl hydrolase family 1.
PRK13511	PRK13511	8.23e-82	7	466	4	468	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	3.24e-64	7	460	3	468	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.39e-59	4	460	2	469	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAR44980.1	0.0	1	475	1	475
APZ04591.1	0.0	1	475	1	475
QNQ21756.1	0.0	1	475	1	475
AZI86278.1	0.0	1	475	1	475
AST70717.1	0.0	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	2.20e-118	6	466	1	461	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.28e-117	6	466	2	462	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	2.63e-116	4	460	16	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	1.05e-115	4	460	16	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	8.97e-76	4	460	7	444	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	5.76e-126	3	460	4	459	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P10482	3.72e-63	6	457	3	446	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P26208	6.52e-62	6	460	4	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q9FIW4	2.45e-61	3	459	16	477	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
P22505	2.92e-58	1	460	1	442	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003883_02120.