CAZyme Information: MGYG000003882_01415

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella
• CAZyme ID: MGYG000003882_01415
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000003882_135|CGC1	41685.37	5.3392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003882	3911502	MAG	United States	North America

• Gene Location: Start: 1747; End: 2844 Strand: -

Full Sequence      

MSPKINRPETLLLIETLIDNLTAIADDSGQYLQRLADGRVIDTKGWEGWEWTHGIGLFGL
FRYQQLTGSPRALQLIDDWFSNRFAEGTPEKNINTACPFLTLALRYQQEPRSDWRAYLEC
WGDAIYRQMPRTDEGCLQHVTYESAHQQQIWDDTLMMAVLPLAMLGKMFDKPRWVEEAKF
QFLQHLHYLSDRQSGLWFHGWHFDGRHHFAGALWARGNSWITLAIPELLEMLNLDEHDAF
YRQLQNTLRIQVNALALCQGENGLWPTLLNDPHSYQEASATAGFAAGIFKAVRLGYLDDA
FLPVAERAFQGIVDHISPQGELTQVSFGTAMGADLDHYRNIALTAMPYGQAMAMLCLVEA
LHRTL

Enzyme Prediction     

No EC number prediction in MGYG000003882_01415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	45	361	4.9e-102	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.37e-100	20	361	7	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.23e-93	34	361	12	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFU63395.1	1.54e-248	1	365	1	365
VEB71086.1	8.88e-248	1	365	1	365
AZJ26818.1	8.88e-248	1	365	1	365
QQD69905.1	8.88e-248	1	365	1	365
BBR14047.1	8.88e-248	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.07e-147	5	362	21	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.91e-145	2	363	12	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.24e-116	14	363	12	371	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	1.66e-09	49	332	39	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.78e-09	49	332	29	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.16e-40	49	361	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	9.07e-09	49	332	39	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.11e-07	166	297	10	147	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.11e-07	166	297	10	147	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003882_01415.