CAZyme Information: MGYG000003882_00296

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella
• CAZyme ID: MGYG000003882_00296
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000003882_16|CGC1	65043.29	4.016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003882	3911502	MAG	United States	North America

• Gene Location: Start: 253; End: 2040 Strand: +

Full Sequence      

MAEGAEQCGKVQYEPTFLDPWGDFQSYVNVGHSVSGWDVDPKTVTQTNTKGLLGGLRDLQ
AKAKQQSHNLVLSMSIGGWSMSNGFHETAASDSSRKVFAKGVVKLFKQFPMFSEVDIDWE
YPNAEGAGNPYGPEDGDNYALLIAELRKQLDSAGLSDVKISIASSAVVKTFDYSNVKALL
SAGLYGINVMTYDFFGTPWAESITHHTNLKALEQGGWAVNTIVEHLLAEGFPAERINIGY
AGYTRNGRGAELESLSPLKGTYNAGTGTTVGTFESGTSEWYDVIYNYLDLENQKGRNGFN
VYTDQVADADFLYNPESKLFMSLDTPRTVKAKGEYAASLGLGGLFTWTIDHDNGVLVNAA
REGLGYEIASETIDMDPFYFEGINVVPADEEDDADQEDDQTEPTVNHAPKAAIEMMVVGG
SRVRLSGEKSSDEDSDELSYSWGVPAAIDVADKTAATIEFDVPVVTADTEFTFTLFVRDT
WGEPSTQQRFILSVVVASEDGQSDDKPADEPADEPADDEKDADDATPAQDDDVAPSDDTT
PYPLWDAKTVYGGTWGTFETVSWKGHNYQVKWWSQGNQPDLNCSQYAVWKDLGAY

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	37	354	8e-56	0.8581081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3325	ChiA	3.81e-112	2	368	87	440	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd06548	GH18_chitinase	5.03e-88	37	352	56	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	1.30e-57	38	352	32	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.51e-57	38	352	35	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	2.16e-33	64	352	65	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXC64683.1	0.0	1	595	116	710
QGT22744.1	0.0	1	595	116	710
QDK14423.1	0.0	1	595	116	710
QGT27606.1	0.0	1	595	116	710
QGT17960.1	0.0	1	595	116	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OGD_C	9.14e-94	4	385	229	622	Cryo-EMstructure of YenTcA in its prepore state [Yersinia entomophaga],6OGD_F Cryo-EM structure of YenTcA in its prepore state [Yersinia entomophaga],6OGD_I Cryo-EM structure of YenTcA in its prepore state [Yersinia entomophaga],6OGD_L Cryo-EM structure of YenTcA in its prepore state [Yersinia entomophaga],6OGD_O Cryo-EM structure of YenTcA in its prepore state [Yersinia entomophaga]
4DWS_C	2.85e-93	4	385	142	535	CrystalStructure of a chitinase from the Yersinia entomophaga toxin complex [Yersinia entomophaga]
4DWS_A	5.63e-93	4	385	142	535	CrystalStructure of a chitinase from the Yersinia entomophaga toxin complex [Yersinia entomophaga]
4DWS_D	2.19e-92	4	385	142	535	CrystalStructure of a chitinase from the Yersinia entomophaga toxin complex [Yersinia entomophaga]
4DWS_B	3.08e-92	4	385	142	535	CrystalStructure of a chitinase from the Yersinia entomophaga toxin complex [Yersinia entomophaga]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6A879	5.01e-93	4	385	229	622	Chitinase 2 OS=Yersinia entomophaga OX=935293 GN=chi2 PE=1 SV=1
B6A876	1.64e-90	18	387	158	526	Chitinase 1 OS=Yersinia entomophaga OX=935293 GN=chi1 PE=1 SV=1
P20533	6.03e-40	19	364	120	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P32823	1.96e-34	23	494	219	679	Chitinase A OS=Pseudoalteromonas piscicida OX=43662 GN=chiA PE=1 SV=1
P07254	2.44e-33	9	365	220	557	Chitinase A OS=Serratia marcescens OX=615 GN=chiA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003882_00296.