CAZyme Information: MGYG000003882_00108

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella
• CAZyme ID: MGYG000003882_00108
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000003882_4|CGC2	62050.63	9.8654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003882	3911502	MAG	United States	North America

• Gene Location: Start: 17760; End: 19415 Strand: -

Full Sequence      

MKSIRYGVSLVVLFALYYLLPLNFRLLWQPDETRYAEISREMLASGDWVVPHLLGLRYFE
KPIAGYWINSIGQWLFGHNNFGVRFGAVFSITVSALLVAWLAWRIFRDKRVAILSPIIFL
TALLVYGIGTYAVLDPMITMWLALAMCSFWGASQAQSRSGKIWGYVLLGIACGMGVMTKG
FLALAVPVVGVLPWVIARKRWREVLTYGWLAVVVCTLVVLPWGLAIANREPDFWRYFFWV
EHIQRFAEKDAQHKAPFWYYIPFLIAGSLPWLALLPGALKRGWSERDDARGALYLLGWVA
MPFLFFSIAKGKLPTYILPCFMPLSILMARYALDAARAGAKALRINGMINLGFGLLGLVA
VLVVSPWGVMRQPVWTQIELYKCLLAAIAFAVWALMGWLAIKDNGRRWTLAAICPLGLAL
VVGFAIPDRVINSKQPQFLVDIVSESLAPSRYVLTNSVGIGAGLAWELKRNDIILYERQG
ELKYGLDWPDAQTKFVATNAFTDWLATHRQQGPISLVLLMDKGETMNELALPKPDNSYVL
GRVVFIQYLPQ

Enzyme Prediction     

No EC number prediction in MGYG000003882_00108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	518	3.5e-150	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	550	2	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	9.42e-96	1	524	3	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.74e-41	3	237	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	6.23e-11	61	222	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMR40127.1	0.0	1	551	1	551
QVJ11371.1	0.0	1	551	1	551
QIP23088.1	0.0	1	551	1	551
ATY05223.1	0.0	1	551	1	551
AMQ60294.1	0.0	1	551	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.28e-31	7	426	39	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TF96	0.0	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1
B5XTL1	0.0	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
B7LM74	1.97e-255	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
A4WAM1	6.62e-252	1	548	1	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
B7N5M2	5.61e-250	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000034	0.000006	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
7	29
81	103
112	134
175	197
204	226
257	279
292	309
314	333
346	368
383	401
408	427